Protein A/G Protein, Staphylococcus aureus
Based on 1 Customer Validation
Protein A/G is a recombinant fusion protein that combines IgG binding domains of both protein A and protein G. Protein A/G can be used for purifying polyclonal or monoclonal IgG antibodies. Protein A/G Protein, Staphylococcus aureus is the recombinant Protein A/G protein, expressed by E. coli, with no tag.
- Species: Staphylococcus aureus
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
Protein A/G is a recombinant fusion protein that combines IgG binding domains of both protein A and protein G. Protein A/G can be used for purifying polyclonal or monoclonal IgG antibodies. Protein A/G Protein, Staphylococcus aureus is the recombinant Protein A/G protein, expressed by E. coli, with no tag[1][2].
Background
Protein A is a type I membrane protein covalently linked to the cell wall of most strains of the Gram-positive bacterium Staphylococcus aureus. Protein G is a bacterial cell wall protein expressed at the cell surface of certain group C and group G Streptococcal strains. Both protein have high affinity to IgG from various species. Protein A/G is a recombinant fusion protein that combines IgG binding domains of both protein A and protein G. Protein A/G contains four Fc binding domains from protein A and two from protein G, yielding a final mass of 50,460 daltons. The binding of protein A/G is less pH-dependent than protein A, but otherwise has the additive properties of protein A and G. Protein A/G's binding affinity is broader than that of Protein A or Protein G alone, making it useful for purifying polyclonal or monoclonal IgG antibodies whose subclasses have not been determined[1][2].
Technical Parameters
-
Species Staphylococcus aureus
-
Source E. coli
-
Tag Tag Free
-
Accession
P02976 (N35-D330)&P19909 (L298-E497)
-
Gene ID/
-
Protein Length
Partial
-
Synonyms
Immunoglobulin G-binding protein A; IgG-binding protein A; Staphylococcal protein A; spa; SAOUHSC_00069; Immunoglobulin G-binding protein G; spg; IgG-binding protein G
-
AA Sequence
NAAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDSLEGSGSGTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
-
Predicted Molecular Mass
47.7 kDa
-
Molecular Weight
Approximately 47 kDa, based on SDS-PAGE under reducing conditions.
-
Structure/Form
Monomer
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered additive free solution.
<0.1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
