1. Recombinant Proteins
  2. Others
  3. Protein A/G Protein, Staphylococcus aureus

Protein A/G is a recombinant fusion protein that combines IgG binding domains of both protein A and protein G. Protein A/G can be used for purifying polyclonal or monoclonal IgG antibodies. Protein A/G Protein, Staphylococcus aureus is the recombinant Protein A/G protein, expressed by E. coli, with no tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Protein A/G is a recombinant fusion protein that combines IgG binding domains of both protein A and protein G. Protein A/G can be used for purifying polyclonal or monoclonal IgG antibodies. Protein A/G Protein, Staphylococcus aureus is the recombinant Protein A/G protein, expressed by E. coli, with no tag[1][2].

Background

Protein A is a type I membrane protein covalently linked to the cell wall of most strains of the Gram-positive bacterium Staphylococcus aureus. Protein G is a bacterial cell wall protein expressed at the cell surface of certain group C and group G Streptococcal strains. Both protein have high affinity to IgG from various species. Protein A/G is a recombinant fusion protein that combines IgG binding domains of both protein A and protein G. Protein A/G contains four Fc binding domains from protein A and two from protein G, yielding a final mass of 50,460 daltons. The binding of protein A/G is less pH-dependent than protein A, but otherwise has the additive properties of protein A and G. Protein A/G's binding affinity is broader than that of Protein A or Protein G alone, making it useful for purifying polyclonal or monoclonal IgG antibodies whose subclasses have not been determined[1][2].

In Vitro

Protein A/G Protein, Staphylococcus aureus can be used to produce affinity membranes capable of specifically capturing IgG molecules[1].
Protein A/G Protein, Staphylococcus aureus can be used for antibody immobilization[2].

Species

Staphylococcus aureus

Source

E. coli

Tag

Tag Free

Accession

P02976 (N35-D330)&P19909 (L298-E497)

Gene ID

/

Protein Length

Partial

Synonyms
Immunoglobulin G-binding protein A & Immunoglobulin G-binding protein G; Protein A/G
AA Sequence

NAAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDSLEGSGSGTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE

Predicted Molecular Mass
47.7 kDa
Molecular Weight

Approximately 47 kDa, based on SDS-PAGE under reducing conditions.

Structure/Form
Monomer
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered additive free solution.

Endotoxin Level

<0.1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Protein A/G Protein, Staphylococcus aureus Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Protein A/G Protein, Staphylococcus aureus

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Protein A/G Protein, Staphylococcus aureus
Cat. No.:
HY-P700331A
Quantity:
MCE Japan Authorized Agent: