Protein A/G Protein, Staphylococcus aureus

Protein A/G is a recombinant fusion protein that combines IgG binding domains of both protein A and protein G. Protein A/G can be used for purifying polyclonal or monoclonal IgG antibodies. Protein A/G Protein, Staphylococcus aureus is the recombinant Protein A/G protein, expressed by E. coli, with no tag^[1][2].

Protein A is a type I membrane protein covalently linked to the cell wall of most strains of the Gram-positive bacterium Staphylococcus aureus. Protein G is a bacterial cell wall protein expressed at the cell surface of certain group C and group G Streptococcal strains. Both protein have high affinity to IgG from various species. Protein A/G is a recombinant fusion protein that combines IgG binding domains of both protein A and protein G. Protein A/G contains four Fc binding domains from protein A and two from protein G, yielding a final mass of 50,460 daltons. The binding of protein A/G is less pH-dependent than protein A, but otherwise has the additive properties of protein A and G. Protein A/G's binding affinity is broader than that of Protein A or Protein G alone, making it useful for purifying polyclonal or monoclonal IgG antibodies whose subclasses have not been determined^[1][2].

Protein A/G Protein, Staphylococcus aureus can be used to produce affinity membranes capable of specifically capturing IgG molecules^[1].
Protein A/G Protein, Staphylococcus aureus can be used for antibody immobilization^[2].

Staphylococcus aureus

E. coli

Tag Free

P02976 (N35-D330)&P19909 (L298-E497)

/

Partial

NAAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDSLEGSGSGTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE

Approximately 47 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered additive free solution.

<0.1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Ma ZW, et al. Electrospun regenerated cellulose nanofiber affinity membrane functionalized with protein A/G for IgG purification. J. Membr. Sci. 2008 Jul 1;319(1-2):23-28.

  [2]. Neubert H, et al. Enhanced affinity capture MALDI-TOF MS: orientation of an immunoglobulin G using recombinant protein G. Anal Chem. 2002 Aug 1;74(15):3677-83.