PRPS2 Protein, Human (His)

The PRPS2 protein plays a key role in catalyzing the synthesis of phosphoribosyl pyrophosphate (PRPP), a key intermediate in nucleotide synthesis. By promoting the conversion of ribose 5-phosphate and ATP to PRPP, PRPS2 contributes to the availability of PRPP in various cellular processes, including de novo biosynthesis of purine and pyrimidine nucleotides. PRPS2 Protein, Human (His) is the recombinant human-derived PRPS2 protein, expressed by E. coli , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The PRPS2 protein plays a key role in catalyzing the synthesis of phosphoribosyl pyrophosphate (PRPP), a key intermediate in nucleotide synthesis. By promoting the conversion of ribose 5-phosphate and ATP to PRPP, PRPS2 contributes to the availability of PRPP in various cellular processes, including de novo biosynthesis of purine and pyrimidine nucleotides. PRPS2 Protein, Human (His) is the recombinant human-derived PRPS2 protein, expressed by E. coli , with C-His labeled tag.

Background

Phosphoribosylpyrophosphate Synthetase 2 (PRPS2) is an enzyme crucial for nucleotide biosynthesis as it catalyzes the synthesis of phosphoribosylpyrophosphate (PRPP). PRPP serves as a key precursor in the de novo biosynthesis of purine and pyrimidine nucleotides, essential for DNA and RNA synthesis. The enzymatic activity of PRPS2 involves the transfer of pyrophosphate from ATP to ribose 5-phosphate, forming PRPP. This reaction represents a critical step in the purine and pyrimidine salvage pathways, providing the necessary building blocks for cellular nucleotide pools. The role of PRPS2 in synthesizing PRPP underscores its significance in supporting fundamental cellular processes, including the maintenance of genetic material and cellular proliferation.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • PRPS2 (M1-L318)
      Accession # P11908-1
    • His
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    PRPS2; Testicular Secretory Protein Li 41; Phosphoribosyl Pyrophosphate Synthetase 2; Ribose-Phosphate Diphosphokinase; Phosphoribosyl Pyrophosphate Synthase II; PPRibP Synthetase; Ribose-Phosphate Pyrophosphokinase 2; PRS II; Ribose-Phosphate Diphosphoki

  • AA Sequence

    MPNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRGEDVYIIQSGCGEINDNLMELLIMINACKIASSSRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLQWIRENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAVVVTNTIPQEDKMKHCTKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL

  • Predicted Molecular Mass

    35.6 kDa

  • Molecular Weight

    Approximately 36 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00