PRSS2/Trypsin-2 Protein, Human (His)
PRSS2 Protein plays an important role in the metastasis and recurrence of multiple tumor types through its actions of destroying the ECM and activating MMPs. PRSS2/Trypsin-2 Protein, Human (His) is the recombinant mouse-derived PRSS2/Trypsin-2 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Help & FAQs
Biological Activity
Description
PRSS2 Protein plays an important role in the metastasis and recurrence of multiple tumor types through its actions of destroying the ECM and activating MMPs. PRSS2/Trypsin-2 Protein, Human (His) is the recombinant mouse-derived PRSS2/Trypsin-2 protein, expressed by E. coli , with N-His labeled tag.
Background
PRSS2 Protein plays an important role in the metastasis and recurrence of multiple tumor types through its actions of destroying the ECM and activating MMPs. PRSS2 enables calcium ion binding activity and serine-type endopeptidase activity. PRSS2 is involved in proteolysis, response to caffeine and response to nicotine.PRSS2 acst upstream of or within digestion[1][2][3].
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P07478 (I24-S247)
-
Gene ID5645
-
Molecular Construction
-
N-term
-
6*His
-
PRSS2 (I24-S247)
Accession # P07478 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
PRSS2; Protease Serine 2 Preproprotein; Serine Protease 2; Protease, Serine, 2 (Trypsin 2); TRY2; Trypsinogen 2; Anionic Trypsinogen; PRSS2 Protein; Protease, Serine 2; Trypsinogen 8; Trypsin II; Trypsin 2; Trypsin-2; Trypsin; TRYP2; TRY8
-
AA Sequence
IVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIKDTIAANS
-
Predicted Molecular Mass
31.0 kDa
-
Molecular Weight
Approximately 34 kDa,based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
