PSCA Protein, Mouse (Biotinylated, HEK293, His-Avi)
PSCA protein is a multifunctional regulator that may modulate cell proliferation and act as a modulator of nicotinic acetylcholine receptor (nAChR) activity. In vitro experiments showed that it can inhibit nicotine-induced signaling, suggesting interaction with nAChR containing α-3:β-2 or α-7. PSCA, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived PSCA protein, expressed by HEK293, with N-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
PSCA protein is a multifunctional regulator that may modulate cell proliferation and act as a modulator of nicotinic acetylcholine receptor (nAChR) activity. In vitro experiments showed that it can inhibit nicotine-induced signaling, suggesting interaction with nAChR containing α-3:β-2 or α-7. PSCA, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived PSCA protein, expressed by HEK293, with N-6*His labeled tag.
Background
The PSCA protein emerges as a versatile regulator, potentially involved in the modulation of cell proliferation and acting as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro experiments demonstrate its ability to inhibit nicotine-induced signaling, suggesting a potential interaction with alpha-3:beta-2- or alpha-7-containing nAChRs. The dual functionality of PSCA, influencing both cell proliferation and nicotinic acetylcholine receptor activity, underscores its significance in cellular processes and signaling pathways, hinting at its potential role in the intricate balance of cellular homeostasis.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-Avi;C-His
-
Accession
P57096 (L21-N95)
-
Gene ID72373
-
Molecular Construction
-
N-term
-
PSCA (L21-N95)
Accession # P57096 -
Avi-His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Conjugation
Biotin
-
Synonyms
PSCA; LncPSCA; Prostate Stem Cell Antigen; PRO232
-
AA Sequence
LQCYSCTAQMNNRDCLNVQNCSLDQHSCFTSRIRAIGLVTVISKGCSSQCEDDSENYYLGKKNITCCYSDLCNVN
-
Predicted Molecular Mass
12 kDa
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by HPLC.
Product Properties
Solution
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
