PSG6 Protein, Human (sf9, His)
PSG6 Protein, Human (sf9, His) is the recombinant human-derived PSG6 protein, expressed by Sf9 insect cells, with C-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
PSG6 Protein, Human (sf9, His) is the recombinant human-derived PSG6 protein, expressed by Sf9 insect cells, with C-His labeled tag.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
Q00889-2/NP_001027020 (Q35-H424)
-
Molecular Construction
-
N-term
-
PSG6 (Q35-H424)
Accession # Q00889-2/NP_001027020 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
PSG6; PSBG-12; Pregnancy Specific Beta-1-Glycoprotein 6; PSBG-6; Pregnancy-Specific Beta-1-Glycoprotein 10; PSG10; Pregnancy-Specific Beta-1-Glycoprotein 12; PSGGB; Pregnancy-Specific Beta-1-Glycoprotein 6; Pregnancy-Specific Glycoprotein 12; PS-Beta-G-10
-
AA Sequence
QVIIEAKPPKVSEGKDVLLLVHNLPQNLTGYIWYKGQMTDLYHYITSYVVHGQIIYGPAYSGRETVYSNASLLIQNVTQEDAGSYTLHIIKRGDGTGGVTGYFTVTLYSETPKPSISSSNLNPREVMEAVRLICDPETPDASYLWLLNGQNLPMTHRLQLSKTNRTLYLFGVTKYIAGPYECEIRNPVSASRSDPVTLNLLPKLPMPYITINNLNPREKKDVLAFTCEPKSRNYTYIWWLNGQSLPVSPRVKRPIENRILILPSVTRNETGPYQCEIRDRYGGIRSNPVTLNVLYGPDLPRIYPSFTYYRSGENLDLSCFADSNPPAEYSWTINGKFQLSGQKLFIPQITTNHSGLYACSVRNSATGKEISKSMIVKVSGPCHGNQTESH
-
Predicted Molecular Mass
45.3 kDa
-
Molecular Weight
Approximately 58 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
