PSMG3 Protein, Human (His, StrepⅡ)
The PSMG3 protein acts as a chaperone and actively promotes the assembly of the 20S proteasome. It involves potential cooperation with the PSMG1-PSMG2 heterodimer to ensure precise assembly of the proteasome. PSMG3 Protein, Human (His, Strep) is the recombinant human-derived PSMG3 protein, expressed by E. coli , with N-Strep, N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The PSMG3 protein acts as a chaperone and actively promotes the assembly of the 20S proteasome. It involves potential cooperation with the PSMG1-PSMG2 heterodimer to ensure precise assembly of the proteasome. PSMG3 Protein, Human (His, Strep) is the recombinant human-derived PSMG3 protein, expressed by E. coli , with N-Strep, N-6*His labeled tag.
Background
PSMG3 (Proteasome assembly chaperone 3) is a chaperone protein crucial for the assembly of the 20S proteasome, an essential component of the cellular protein degradation machinery. PSMG3 may cooperate with PSMG1-PSMG2 heterodimers to orchestrate the correct assembly of proteasomes. Existing as a homodimer, PSMG3 interacts with PSMG4 and directly engages with both alpha and beta subunits of the 20S proteasome. Notably, it dissociates before the formation of half-proteasomes, likely occurring upon the recruitment of POMP. This highlights PSMG3's role in facilitating the precise assembly of the 20S proteasome, a critical process for maintaining cellular homeostasis through effective protein degradation.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-StrepⅡ;N-6*His
-
Accession
Q9BT73 (M1-W122)
-
Gene ID84262
-
Molecular Construction
-
N-term
-
StrepⅡ-6*His
-
PSMG3 (M1-W122)
Accession # Q9BT73 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
PSMG3; MGC10911; Prev. C7orf48; HPAC3; PAC3; Pba3; Proteasome (Prosome, Macropain) Assembly Chaperone 3; Chromosome 7 Open Reading Frame 48; Proteasome Chaperone Homolog 3; Proteasome Assembling Chaperone 3; Proteasome Assembly Chaperone 3; PAC-3
-
AA Sequence
MEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)