PSMG3 Protein, Human (His, StrepⅡ)

The PSMG3 protein acts as a chaperone and actively promotes the assembly of the 20S proteasome. It involves potential cooperation with the PSMG1-PSMG2 heterodimer to ensure precise assembly of the proteasome. PSMG3 Protein, Human (His, Strep) is the recombinant human-derived PSMG3 protein, expressed by E. coli , with N-Strep, N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The PSMG3 protein acts as a chaperone and actively promotes the assembly of the 20S proteasome. It involves potential cooperation with the PSMG1-PSMG2 heterodimer to ensure precise assembly of the proteasome. PSMG3 Protein, Human (His, Strep) is the recombinant human-derived PSMG3 protein, expressed by E. coli , with N-Strep, N-6*His labeled tag.

Background

PSMG3 (Proteasome assembly chaperone 3) is a chaperone protein crucial for the assembly of the 20S proteasome, an essential component of the cellular protein degradation machinery. PSMG3 may cooperate with PSMG1-PSMG2 heterodimers to orchestrate the correct assembly of proteasomes. Existing as a homodimer, PSMG3 interacts with PSMG4 and directly engages with both alpha and beta subunits of the 20S proteasome. Notably, it dissociates before the formation of half-proteasomes, likely occurring upon the recruitment of POMP. This highlights PSMG3's role in facilitating the precise assembly of the 20S proteasome, a critical process for maintaining cellular homeostasis through effective protein degradation.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-StrepⅡ;N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • StrepⅡ-6*His
    • PSMG3 (M1-W122)
      Accession # Q9BT73
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    PSMG3; MGC10911; Prev. C7orf48; HPAC3; PAC3; Pba3; Proteasome (Prosome, Macropain) Assembly Chaperone 3; Chromosome 7 Open Reading Frame 48; Proteasome Chaperone Homolog 3; Proteasome Assembling Chaperone 3; Proteasome Assembly Chaperone 3; PAC-3

  • AA Sequence

    MEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00