1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. PTP4A2 Protein, Human (GST)

The PTP4A2 protein is an influential tyrosine phosphatase that stimulates G1 to S phase progression and contributes to cell cycle regulation. Notably, it promotes tumorigenesis, revealing its involvement in cancer development. PTP4A2 Protein, Human (GST) is the recombinant human-derived PTP4A2 protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PTP4A2 protein is an influential tyrosine phosphatase that stimulates G1 to S phase progression and contributes to cell cycle regulation. Notably, it promotes tumorigenesis, revealing its involvement in cancer development. PTP4A2 Protein, Human (GST) is the recombinant human-derived PTP4A2 protein, expressed by E. coli , with N-GST labeled tag.

Background

PTP4A2 protein, a potent protein tyrosine phosphatase, plays a pivotal role in stimulating the progression from G1 into S phase during mitosis, contributing to cell cycle regulation. Intriguingly, PTP4A2 emerges as a promoter of tumorigenesis, showcasing its involvement in pathological processes associated with cancer development. Additionally, PTP4A2 exhibits inhibitory effects on geranylgeranyl transferase type II activity by disrupting the association between RABGGTA and RABGGTB, indicating its regulatory influence on intracellular signaling pathways. The multifaceted functions of PTP4A2 underscore its significance in cellular processes related to both cell cycle dynamics and the intricate mechanisms underlying tumor progression.

Species

Human

Source

E. coli

Tag

N-GST

Accession

Q12974 (N2-Q167)

Gene ID
Molecular Construction
N-term
GST
PTP4A2 (N2-Q167)
Accession # Q12974
C-term
Protein Length

Partial

Synonyms
Protein tyrosine phosphatase type IVA 2; HU-PP-1; PRL-2; PTPCAAX2
AA Sequence

NRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFRDTNGHCCVQ

Predicted Molecular Mass
45.9 kDa
Molecular Weight

Approximately 45 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PTP4A2 Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PTP4A2 Protein, Human (GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PTP4A2 Protein, Human (GST)
Cat. No.:
HY-P77169
Quantity:
MCE Japan Authorized Agent: