PTP4A2 Protein, Human (GST)
The PTP4A2 protein is an influential tyrosine phosphatase that stimulates G1 to S phase progression and contributes to cell cycle regulation. Notably, it promotes tumorigenesis, revealing its involvement in cancer development. PTP4A2 Protein, Human (GST) is the recombinant human-derived PTP4A2 protein, expressed by E. coli , with N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The PTP4A2 protein is an influential tyrosine phosphatase that stimulates G1 to S phase progression and contributes to cell cycle regulation. Notably, it promotes tumorigenesis, revealing its involvement in cancer development. PTP4A2 Protein, Human (GST) is the recombinant human-derived PTP4A2 protein, expressed by E. coli , with N-GST labeled tag.
Background
PTP4A2 protein, a potent protein tyrosine phosphatase, plays a pivotal role in stimulating the progression from G1 into S phase during mitosis, contributing to cell cycle regulation. Intriguingly, PTP4A2 emerges as a promoter of tumorigenesis, showcasing its involvement in pathological processes associated with cancer development. Additionally, PTP4A2 exhibits inhibitory effects on geranylgeranyl transferase type II activity by disrupting the association between RABGGTA and RABGGTB, indicating its regulatory influence on intracellular signaling pathways. The multifaceted functions of PTP4A2 underscore its significance in cellular processes related to both cell cycle dynamics and the intricate mechanisms underlying tumor progression.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
Q12974 (N2-Q167)
-
Molecular Construction
-
N-term
-
GST
-
PTP4A2 (N2-Q167)
Accession # Q12974 -
C-term
-
-
Protein Length
Full Length of Protein tyrosine phosphatase type IVA 2 Chain
-
Synonyms
PTP4A2; Protein Tyrosine Phosphatase Type IVA, Member 2; Prev. PTP4A; Phosphatase Of Regenerating Liver 2; PTPCAAX2; PTP(CAAXII); HU-PP-1; Protein Tyrosine Phosphatase IVA2; PRL-2; Protein Tyrosine Phosphatase IVA; OV-1; Protein-Tyrosine Phosphatase 4a2;
-
AA Sequence
NRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFRDTNGHCCVQ
-
Predicted Molecular Mass
45.9 kDa
-
Molecular Weight
Approximately 45 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
