PUS7 Protein, Human (sf9, His, Strep)
Based on 1 Customer Validation
PUS7 Protein, Human (sf9, His, Strep) is the recombinant human-derived PUS7, expressed by sf9 insect cells , with Strep, His labeled tag. ,
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
PUS7 Protein, Human (sf9, His, Strep) is the recombinant human-derived PUS7, expressed by sf9 insect cells , with Strep, His labeled tag. ,
Background
PUS7 is a pseudouridylate synthase that catalyzes pseudouridylation of RNAs. It regulates protein synthesis in embryonic stem cells by mediating pseudouridylation of tRNA fragments (tRFs), where pseudouridylated tRFs inhibit translation by targeting the translation initiation complex. Additionally, PUS7 catalyzes pseudouridylation of mRNAs with the consensus sequence 5'-UGUAG-3'. It also regulates pre-mRNA splicing by mediating pseudouridylation at alternative splicing regions, with modifications near splice sites directly affecting mRNA splicing and 3'-end processing. Beyond mRNAs and tRNAs, PUS7 binds other RNA types such as snRNAs, Y RNAs, and vault RNAs, suggesting broad RNA pseudouridylation activity. by similar: Pseudouridylation plays a versatile role in RNA function regulation.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-His;N-StrepⅡ
-
Accession
Q96PZ0-1 (E2-R661)
-
Gene ID54517
-
Protein Length
Full Length of Isoform-1
-
Synonyms
PUS7; FLJ20485; Pseudouridine Synthase 7; Pseudouridylate Synthase 7 Homolog (S. Cerevisiae); Pseudouridylate Synthase 7 (Putative); KIAA1897; Pseudouridylate Synthase 7 Homolog; IDDABS; Pseudouridylate Synthase 7
-
AA Sequence
EMTEMTGVSLKRGALVVEDNDSGVPVEETKKQKLSECSLTKGQDGLQNDFLSISEDVPRPPDTVSTGKGGKNSEAQLEDEEEEEEDGLSEECEEEESESFADMMKHGLTEADVGITKFVSSHQGFSGILKERYSDFVVHEIGKDGRISHLNDLSIPVDEEDPSEDIFTVLTAEEKQRLEELQLFKNKETSVAIEVIEDTKEKRTIIHQAIKSLFPGLETKTEDREGKKYIVAYHAAGKKALANPRKHSWPKSRGSYCHFVLYKENKDTMDAINVLSKYLRVKPNIFSYMGTKDKRAITVQEIAVLKITAQRLAHLNKCLMNFKLGNFSYQKNPLKLGELQGNHFTVVLRNITGTDDQVQQAMNSLKEIGFINYYGMQRFGTTAVPTYQVGRAILQNSWTEVMDLILKPRSGAEKGYLVKCREEWAKTKDPTAALRKLPVKRCVEGQLLRGLSKYGMKNIVSAFGIIPRNNRLMYIHSYQSYVWNNMVSKRIEDYGLKPVPGDLVLKGATATYIEEDDVNNYSIHDVVMPLPGFDVIYPKHKIQEAYREMLTADNLDIDNMRHKIRDYSLSGAYRKIIIRPQNVSWEVVAYDDPKIPLFNTDVDNLEGKTPPVFASEGKYRALKMDFSLPPSTYATMAIREVLKMDTSIKNQTQLNTTWLR
-
Predicted Molecular Mass
78.1 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (238 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
