1. Recombinant Proteins
  2. Others
  3. QKI Protein, Human (His, Strep)

QKI Protein, Human (His, Strep) is the recombinant human-derived QKI, expressed by E. coli , with Strep, His labeled tag. ,

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

QKI Protein, Human (His, Strep) is the recombinant human-derived QKI, expressed by E. coli , with Strep, His labeled tag. ,

Background

QKI is an RNA reader protein that recognizes and binds specific RNAs, regulating RNA metabolic processes such as pre-mRNA splicing, circular RNA (circRNA) formation, mRNA export, mRNA stability, and/or translation. It is involved in various cellular processes, including mRNA storage into stress granules, apoptosis, lipid deposition, interferon response, glial cell fate, and development. QKI binds to the 5'-NACUAAY-N(1,20)-UAAY-3' RNA core sequence and acts as an mRNA modification reader, specifically recognizing and binding mRNA transcripts modified by internal N(7)-methylguanine (m7G). During epithelial to mesenchymal transition and in cardiomyocytes, QKI promotes the formation of circRNAs by binding to sites flanking circRNA-forming exons, which are produced by back-splicing circularization of pre-mRNAs. QKI plays a central role in myelination through three distinct mechanisms: 1) protecting and stabilizing target mRNAs (e.g., MBP, SIRT2, and CDKN1B) to promote oligodendrocyte differentiation (by similarity); 2) regulating the nuclear export of MBP mRNA for mRNA transport (by similarity); and 3) indirectly regulating MAG pre-mRNA splicing during oligodendrocyte differentiation by binding to HNRNPA1 mRNA splicing factor (by similarity). It also regulates microexon alternative splicing of the Rho GTPase pathway in microglia differentiation and remyelination (by similarity) and promotes monocyte differentiation by regulating pre-mRNA splicing in naive peripheral blood monocytes. QKI is a key regulator of muscle development, maintaining cardiomyocyte contractile function by regulating alternative splicing of cardiomyocyte transcripts (by similarity), while suppressing thermogenesis by reducing the stability, nuclear export, and translation of PPARGC1A and UCP1 mRNAs (by similarity). Additionally, QKI is involved in visceral endoderm function, blood vessel development (by similarity), and may contribute to smooth muscle development. Beyond its RNA-binding activity, QKI acts as a nuclear transcription coactivator for SREBF2/SREBP2 (by similarity).

Species

Human

Source

E. coli

Tag

Strep;His

Accession

Q96PU8-1 (T7-L214)

Gene ID

9444

Protein Length

Partial

Synonyms
HKQ
AA Sequence

TKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPAL

Predicted Molecular Mass
26.9 kDa
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

QKI Protein, Human (His, Strep) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

QKI Protein, Human (His, Strep)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
QKI Protein, Human (His, Strep)
Cat. No.:
HY-P703268
Quantity:
MCE Japan Authorized Agent: