RAB27B Protein, Human (HEK293)
RAB27B is a dynamic small GTPase that regulates the late endocytic pathway by cycling between its active GTP-bound and inactive GDP-bound states. In the active state, RAB27B interacts with multiple effectors to coordinate endosomal localization, maturation, and secretion. RAB27B Protein, Human (HEK293) is the recombinant human-derived RAB27B protein, expressed by HEK293 , with tag free.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
RAB27B is a dynamic small GTPase that regulates the late endocytic pathway by cycling between its active GTP-bound and inactive GDP-bound states. In the active state, RAB27B interacts with multiple effectors to coordinate endosomal localization, maturation, and secretion. RAB27B Protein, Human (HEK293) is the recombinant human-derived RAB27B protein, expressed by HEK293 , with tag free.
Background
RAB27B, a small GTPase, undergoes dynamic cycling between its active GTP-bound and inactive GDP-bound states, exerting regulatory control over the late endocytic pathway's homeostasis. In its active state, RAB27B engages with a diverse set of effector proteins, contributing to the coordination of endosomal positioning, maturation, and secretion processes. Notably, it plays a crucial role in facilitating the axonal anterograde transport of NTRK2/TRKB by promoting the association of NTRK2/TRKB with KLC1. Additionally, RAB27B may participate in the targeting of uroplakins to urothelial apical membranes, suggesting its involvement in specialized membrane trafficking events.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
O00194 (T2-K215)
-
Molecular Construction
-
N-term
-
RAB27B (T2-K215)
Accession # O00194 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
RAB27B; C25KG; RAB27B, Member RAS Oncogene Family; Small Monomeric GTPase; Ras-Related Protein Rab-27B
-
AA Sequence
TDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKK
-
Predicted Molecular Mass
24.3 kDa
-
Molecular Weight
Approximately 27 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
