RBM38 Protein, Human (His)
RBM38 Protein, Human (His) is the recombinant human-derived RBM38, expressed by E. coli , with His labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
RBM38 Protein, Human (His) is the recombinant human-derived RBM38, expressed by E. coli , with His labeled tag. ,
Background
RBM38 is an RNA-binding protein that specifically binds to the 3'-UTR of CDKN1A transcripts to maintain their stability, thereby acting as a mediator of the p53/TP53 family to regulate CDKN1A. CDKN1A, a cyclin-dependent kinase inhibitor transcriptionally regulated by the p53/TP53 family, induces cell cycle arrest. Isoform 1 (but not isoform 2) can induce G1-phase cell cycle arrest and stabilize p53/TP53-induced CDKN1A transcripts. Additionally, RBM38 functions as an mRNA splicing factor, specifically regulating the expression of the epithelial cell-specific isoform FGFR2-IIIb, and plays a role in myogenic differentiation.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag His
-
Accession
Q9H0Z9-1 (G26-G121)
-
Gene ID55544
-
Protein Length
Partial
-
Synonyms
RBM38; DJ800J21.2; Prev. RNPC1; Seb4B; HSRNASEB; RNA-Binding Region (RNP1, RRM) Containing 1; RNA-Binding Region-Containing Protein 1; RNA-Binding Motif Protein 38; SsDNA-Binding Protein SEB4; CLL-Associated Antigen KW-5; RNA-Binding Protein 38; SEB4; RNA
-
AA Sequence
GSQKDTTFTKIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAKPRSLQTG
-
Predicted Molecular Mass
13.8 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)