REG-3 alpha/REG3A Protein, Rat (HEK293, His)
REG-3 α/REG3A protein is a bactericidal C-type lectin lacking an EPN motif that acts as a hormone in response to stimuli such as IL17A and the intestinal microbiome. It is secreted by various cell types and activates the receptor EXTL3, initiating cell-specific signaling pathways. REG-3 alpha/REG3A Protein, Rat (HEK293, His) is the recombinant rat-derived REG-3 alpha/REG3A protein, expressed by HEK293 , with C-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
REG-3 α/REG3A protein is a bactericidal C-type lectin lacking an EPN motif that acts as a hormone in response to stimuli such as IL17A and the intestinal microbiome. It is secreted by various cell types and activates the receptor EXTL3, initiating cell-specific signaling pathways. REG-3 alpha/REG3A Protein, Rat (HEK293, His) is the recombinant rat-derived REG-3 alpha/REG3A protein, expressed by HEK293 , with C-His labeled tag.
Background
REG-3 alpha/REG3A Protein is a bactericidal C-type lectin that lacks the EPN motif, which may explain its inability to bind peptidoglycan. It functions as a hormone in response to various stimuli, including anti-inflammatory signals like IL17A and the gut microbiome. REG-3 alpha/REG3A protein is secreted by different cell types and activates its receptor EXTL3, initiating cell-specific signaling pathways. In keratinocytes, it is induced by IL17A and plays a role in regulating keratinocyte proliferation and differentiation following skin injury. It also inhibits skin inflammation by suppressing inflammatory cytokines like IL6 and TNF. In the pancreas, REG-3 alpha/REG3A protein is able to permeabilize beta-cell membranes and stimulate their proliferation.
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-His
-
Accession
P35231 (E26-Q174)
-
Molecular Construction
-
N-term
-
REG3A (E26-Q174)
Accession # P35231 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
REG3A; Proliferation-Inducing Protein 42; Prev. PAP; Reg III-Alpha; PAP1; REG-3-Alpha; HIP; HIP/PAP; REG-III; CDNA FLJ76569, Highly Similar To Homo Sapiens Regenerating Islet-Derived 3 Alpha (REG3A), Transcript Variant 1, MRNA; PBCGF; Regenerating Islet-D
-
AA Sequence
EDSQKAVPSTRTSCPMGSKAYRSYCYTLVTTLKSWFQADLACQKRPSGHLVSILSGGEASFVSSLVTGRVNNNQDIWIWLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGNCGSLTATSEFLKWGDHHCDVELPFVCKFKQ
-
Predicted Molecular Mass
17.9 kDa
-
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
