1. Recombinant Proteins
  2. Others
  3. REG-3 alpha/REG3A Protein, Rat (HEK293, His)

REG-3 α/REG3A protein is a bactericidal C-type lectin lacking an EPN motif that acts as a hormone in response to stimuli such as IL17A and the intestinal microbiome. It is secreted by various cell types and activates the receptor EXTL3, initiating cell-specific signaling pathways. REG-3 alpha/REG3A Protein, Rat (HEK293, His) is the recombinant rat-derived REG-3 alpha/REG3A protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

REG-3 α/REG3A protein is a bactericidal C-type lectin lacking an EPN motif that acts as a hormone in response to stimuli such as IL17A and the intestinal microbiome. It is secreted by various cell types and activates the receptor EXTL3, initiating cell-specific signaling pathways. REG-3 alpha/REG3A Protein, Rat (HEK293, His) is the recombinant rat-derived REG-3 alpha/REG3A protein, expressed by HEK293 , with C-His labeled tag.

Background

REG-3 alpha/REG3A Protein is a bactericidal C-type lectin that lacks the EPN motif, which may explain its inability to bind peptidoglycan. It functions as a hormone in response to various stimuli, including anti-inflammatory signals like IL17A and the gut microbiome. REG-3 alpha/REG3A protein is secreted by different cell types and activates its receptor EXTL3, initiating cell-specific signaling pathways. In keratinocytes, it is induced by IL17A and plays a role in regulating keratinocyte proliferation and differentiation following skin injury. It also inhibits skin inflammation by suppressing inflammatory cytokines like IL6 and TNF. In the pancreas, REG-3 alpha/REG3A protein is able to permeabilize beta-cell membranes and stimulate their proliferation.

Species

Rat

Source

HEK293

Tag

C-His

Accession

P35231 (E26-Q174)

Gene ID
Molecular Construction
N-term
REG3A (E26-Q174)
Accession # P35231
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Regenerating islet-derived protein 3-alpha; REG-3-alpha; Lithostathine 3; PAP2
AA Sequence

EDSQKAVPSTRTSCPMGSKAYRSYCYTLVTTLKSWFQADLACQKRPSGHLVSILSGGEASFVSSLVTGRVNNNQDIWIWLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGNCGSLTATSEFLKWGDHHCDVELPFVCKFKQ

Predicted Molecular Mass
17.9 kDa
Molecular Weight

Approximately 17 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

REG-3 alpha/REG3A Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

REG-3 alpha/REG3A Protein, Rat (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
REG-3 alpha/REG3A Protein, Rat (HEK293, His)
Cat. No.:
HY-P76570
Quantity:
MCE Japan Authorized Agent: