RGM-C Protein, Human (Biotinylated, HEK293, Avi)

RGM-C Protein, a BMP coreceptor, crucially modulates BMP signaling and regulates hepcidin (HAMP) expression, impacting iron homeostasis. It interacts with BMP2, BMP4, BMP6, BMPR1B, and TMPRSS6, forming a molecular network that collectively mediates BMP-related signaling pathways and iron regulation. RGM-C Protein, Human (Biotinylated, HEK293, Avi) is the recombinant human-derived RGM-C protein, expressed by HEK293, with C-Avi labeled tag.

RGM-C operates as a bone morphogenetic protein (BMP) coreceptor, contributing to the modulation of BMP signaling and playing a crucial role in the regulation of hepcidin (HAMP) expression, thereby influencing iron homeostasis. This protein interacts with BMP2, BMP4, BMP6, BMPR1B, and TMPRSS6, forming a network of molecular associations that collectively contribute to its role in mediating BMP-related signaling pathways and iron regulation.

Immobilized Biotinylated Human RGM-C, Avi Tag at 0.5 μg/ml (100 μl/well) on the streptavidin precoated plate (5 μg/ml). Dose response curve for Anti-RGM-C Antibody, hFc Tag with the EC₅₀ of 4.4 ng/ml determined by ELISA.

Human

HEK293

C-Avi

Q6ZVN8-1 (Q36-D400)

148738

Full Length of Isoform-1 Mature Protein

Biotin

QCKILRCNAEYVSSTLSLRGGGSSGALRGGGGGGRGGGVGSGGLCRALRSYALCTRRTARTCRGDLAFHSAVHGIEDLMIQHNCSRQGPTAPPPPRGPALPGAGSGLPAPDPCDYEGRFSRLHGRPPGFLHCASFGDPHVRSFHHHFHTCRVQGAWPLLDNDFLFVQATSSPMALGANATATRKLTIIFKNMQECIDQKVYQAEVDNLPVAFEDGSINGGDRPGGSSLSIQTANPGNHVEIQAAYIGTTIIIRQTAGQLSFSIKVAEDVAMAFSAEQDLQLCVGGCPPSQRLSRSERNRRGAITIDTARRLCKEGLPVEDAYFHSCVFDVLISGDPNFTVAAQAALEDARAFLPDLEKLHLFPSD

Approximately 55-60 kDa & 30-40 kDa & 20-25 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.