Copy Link Print Information

RGM-C Protein, Human (Biotinylated, HEK293, Avi)

Customer Review

Based on 1 Customer Validation

RGM-C Protein, a BMP coreceptor, crucially modulates BMP signaling and regulates hepcidin (HAMP) expression, impacting iron homeostasis. It interacts with BMP2, BMP4, BMP6, BMPR1B, and TMPRSS6, forming a molecular network that collectively mediates BMP-related signaling pathways and iron regulation. RGM-C Protein, Human (Biotinylated, HEK293, Avi) is the recombinant human-derived RGM-C protein, expressed by HEK293, with C-Avi labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • RGM-C Protein, Human (Biotinylated, HEK293, Avi) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

RGM-C Protein, a BMP coreceptor, crucially modulates BMP signaling and regulates hepcidin (HAMP) expression, impacting iron homeostasis. It interacts with BMP2, BMP4, BMP6, BMPR1B, and TMPRSS6, forming a molecular network that collectively mediates BMP-related signaling pathways and iron regulation. RGM-C Protein, Human (Biotinylated, HEK293, Avi) is the recombinant human-derived RGM-C protein, expressed by HEK293, with C-Avi labeled tag.

Background

RGM-C operates as a bone morphogenetic protein (BMP) coreceptor, contributing to the modulation of BMP signaling and playing a crucial role in the regulation of hepcidin (HAMP) expression, thereby influencing iron homeostasis. This protein interacts with BMP2, BMP4, BMP6, BMPR1B, and TMPRSS6, forming a network of molecular associations that collectively contribute to its role in mediating BMP-related signaling pathways and iron regulation.

Verified Bioactivity

Immobilized Biotinylated Human RGM-C, Avi Tag at 0.5 μg/ml (100 μl/well) on the streptavidin precoated plate (5 μg/ml). Dose response curve for Anti-RGM-C Antibody, hFc Tag with the EC50 of 4.4 ng/ml determined by ELISA.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-Avi
  • Accession

    Q6ZVN8-1 (Q36-D400)

  • Gene ID
    148738
  • Molecular Construction
    • N-term
    • RGM-C (Gln36-Asp400)
      Accession # Q6ZVN8-1
    • Avi
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Conjugation

    Biotin

  • Synonyms

    HJV; Haemojuvelin; Prev. HFE2; JH; Hemojuvelin; Hemochromatosis Type 2 (Juvenile); RGMC; Hemochromatosis Type 2 Protein; RGM Domain Family Member C; Repulsive Guidance Molecule C; Hemojuvelin BMP Coreceptor; Hemojuvelin BMP Co-Receptor; HFE2A

  • AA Sequence

    QCKILRCNAEYVSSTLSLRGGGSSGALRGGGGGGRGGGVGSGGLCRALRSYALCTRRTARTCRGDLAFHSAVHGIEDLMIQHNCSRQGPTAPPPPRGPALPGAGSGLPAPDPCDYEGRFSRLHGRPPGFLHCASFGDPHVRSFHHHFHTCRVQGAWPLLDNDFLFVQATSSPMALGANATATRKLTIIFKNMQECIDQKVYQAEVDNLPVAFEDGSINGGDRPGGSSLSIQTANPGNHVEIQAAYIGTTIIIRQTAGQLSFSIKVAEDVAMAFSAEQDLQLCVGGCPPSQRLSRSERNRRGAITIDTARRLCKEGLPVEDAYFHSCVFDVLISGDPNFTVAAQAALEDARAFLPDLEKLHLFPSD

  • Predicted Molecular Mass

    40 kDa (mature) & 26 kDa (C-terminus peptide) & 14 kDa (N-terminus peptide)

  • Molecular Weight

    Approximately 50-60 kDa (mature) & 30-40 kDa (C-terminus chain) & 20-25 kDa (N-terminus chain), based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • RGM-C Protein, Human (Biotinylated, HEK293, Avi) Product Image
    1/16
  • RGM-C Protein, Human (Biotinylated, HEK293, Avi) Product Image