RGM-C Protein, Human (HEK293, mFc)
RGM-C Protein, a BMP coreceptor, crucially modulates BMP signaling and regulates hepcidin (HAMP) expression, impacting iron homeostasis. It interacts with BMP2, BMP4, BMP6, BMPR1B, and TMPRSS6, forming a molecular network that collectively mediates BMP-related signaling pathways and iron regulation. RGM-C Protein, Human (HEK293, mFc) is the recombinant human-derived RGM-C protein, expressed by HEK293, with C-mFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
RGM-C Protein, a BMP coreceptor, crucially modulates BMP signaling and regulates hepcidin (HAMP) expression, impacting iron homeostasis. It interacts with BMP2, BMP4, BMP6, BMPR1B, and TMPRSS6, forming a molecular network that collectively mediates BMP-related signaling pathways and iron regulation. RGM-C Protein, Human (HEK293, mFc) is the recombinant human-derived RGM-C protein, expressed by HEK293, with C-mFc labeled tag.
Background
RGM-C operates as a bone morphogenetic protein (BMP) coreceptor, contributing to the modulation of BMP signaling and playing a crucial role in the regulation of hepcidin (HAMP) expression, thereby influencing iron homeostasis. This protein interacts with BMP2, BMP4, BMP6, BMPR1B, and TMPRSS6, forming a network of molecular associations that collectively contribute to its role in mediating BMP-related signaling pathways and iron regulation.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-mFc
-
Accession
Q6ZVN8-1 (Q36-P145)
-
Gene ID148738
-
Molecular Construction
-
N-term
-
RGM-C (Gln36-Pro145)
Accession # Q6ZVN8-1 -
mFc
-
C-term
-
-
Protein Length
Partial
-
Synonyms
HJV; Haemojuvelin; Prev. HFE2; JH; Hemojuvelin; Hemochromatosis Type 2 (Juvenile); RGMC; Hemochromatosis Type 2 Protein; RGM Domain Family Member C; Repulsive Guidance Molecule C; Hemojuvelin BMP Coreceptor; Hemojuvelin BMP Co-Receptor; HFE2A
-
AA Sequence
QCKILRCNAEYVSSTLSLRGGGSSGALRGGGGGGRGGGVGSGGLCRALRSYALCTRRTARTCRGDLAFHSAVHGIEDLMIQHNCSRQGPTAPPPPRGPALPGAGSGLPAP
-
Predicted Molecular Mass
37.4 kDa
-
Molecular Weight
Approximately 45-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
