RhoA Protein, Human (sf9, His)
Based on 1 Customer Validation
The RhoA protein is a critical small GTPase that dynamically regulates multiple cellular responses by cycling between an active GTP-bound state and an inactive GDP-bound state. It mainly affects cytoskeletal organization, interacts with various effectors, and affects cytoskeletal dynamics, cell migration, and cell cycle progression. RhoA Protein, Human (sf9, His) is the recombinant human-derived RhoA protein, expressed by Sf9 insect cells , with N-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The RhoA protein is a critical small GTPase that dynamically regulates multiple cellular responses by cycling between an active GTP-bound state and an inactive GDP-bound state. It mainly affects cytoskeletal organization, interacts with various effectors, and affects cytoskeletal dynamics, cell migration, and cell cycle progression. RhoA Protein, Human (sf9, His) is the recombinant human-derived RhoA protein, expressed by Sf9 insect cells , with N-His labeled tag.
Background
RhoA Protein is a small GTPase crucial for orchestrating diverse cellular responses, cycling between an active GTP-bound state and an inactive GDP-bound state. Primarily associated with the organization of the cytoskeleton, the active form of RhoA binds to various effector proteins, influencing cellular processes such as cytoskeletal dynamics, cell migration, and cell cycle progression. It plays a pivotal role in regulating signal transduction pathways that connect plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Additionally, RhoA is indispensable for microtubule-dependent signals required for myosin contractile ring formation during cell cycle cytokinesis, contributing to cleavage furrow formation. Essential for apical junction formation in keratinocyte cell-cell adhesion, RhoA also participates in the MEMO1-RHOA-DIAPH1 signaling pathway, influencing ERBB2-dependent microtubule stabilization. It further modulates potassium channel activity, regulates guanine nucleotide exchange factors, and acts as a target for the yopT cysteine peptidase from Yersinia pestis during microbial infection.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-His
-
Accession
P61586 (M1-L193)
-
Molecular Construction
-
N-term
-
His
-
RhoA (M1-L193)
Accession # P61586 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
RHOA; Ras Homolog Gene Family, Member A; Prev. ARH12; Small GTP Binding Protein RhoA; Prev. ARHA; Rho CDNA Clone 12; Transforming Protein RhoA; Oncogene RHO H12; RHOH12; EDFAOB; Rho12; RHO12; Epididymis Secretory Sperm Binding Protein; H12; Ras Homolog Ge
-
AA Sequence
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
-
Predicted Molecular Mass
24 kDa
-
Molecular Weight
Approximately 28 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, 1 mM TCEP, 10% Glycerol, pH 7.5, 5% trehalose, 5% mannitol, 0.01%
Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
