1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. RhoA Protein, Human (sf9, His)

The RhoA protein is a critical small GTPase that dynamically regulates multiple cellular responses by cycling between an active GTP-bound state and an inactive GDP-bound state. It mainly affects cytoskeletal organization, interacts with various effectors, and affects cytoskeletal dynamics, cell migration, and cell cycle progression. RhoA Protein, Human (sf9, His) is the recombinant human-derived RhoA protein, expressed by Sf9 insect cells , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The RhoA protein is a critical small GTPase that dynamically regulates multiple cellular responses by cycling between an active GTP-bound state and an inactive GDP-bound state. It mainly affects cytoskeletal organization, interacts with various effectors, and affects cytoskeletal dynamics, cell migration, and cell cycle progression. RhoA Protein, Human (sf9, His) is the recombinant human-derived RhoA protein, expressed by Sf9 insect cells , with N-His labeled tag.

Background

RhoA Protein is a small GTPase crucial for orchestrating diverse cellular responses, cycling between an active GTP-bound state and an inactive GDP-bound state. Primarily associated with the organization of the cytoskeleton, the active form of RhoA binds to various effector proteins, influencing cellular processes such as cytoskeletal dynamics, cell migration, and cell cycle progression. It plays a pivotal role in regulating signal transduction pathways that connect plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Additionally, RhoA is indispensable for microtubule-dependent signals required for myosin contractile ring formation during cell cycle cytokinesis, contributing to cleavage furrow formation. Essential for apical junction formation in keratinocyte cell-cell adhesion, RhoA also participates in the MEMO1-RHOA-DIAPH1 signaling pathway, influencing ERBB2-dependent microtubule stabilization. It further modulates potassium channel activity, regulates guanine nucleotide exchange factors, and acts as a target for the yopT cysteine peptidase from Yersinia pestis during microbial infection.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

Sf9 insect cells

Tag

N-His

Accession

P61586 (M1-L193)

Gene ID

387  [NCBI]

Molecular Construction
N-term
His
RhoA (M1-L193)
Accession # P61586
C-term
Protein Length

Full Length

Synonyms
Transforming protein RhoA; RHOA; ARH12; ARHA; RHO12
AA Sequence

MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL

Molecular Weight

Approximately 28 kDa

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 7.4, 10% Glycerol, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

RhoA Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

RhoA Protein, Human (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RhoA Protein, Human (sf9, His)
Cat. No.:
HY-P73676
Quantity:
MCE Japan Authorized Agent: