1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. RIZ1 Protein, Human (GST)

RIZ1 Protein, an S-adenosyl-L-methionine-dependent histone methyltransferase, specifically methylates 'Lys-9' of histone H3. Additionally, it acts as a DNA-binding transcription factor, showing affinity for the MTE within the HMOX1 gene. Implicated as a potential activator, RIZ1 suggests a regulatory role in HMOX1 gene expression beyond histone modification. RIZ1 Protein, Human (GST) is the recombinant human-derived RIZ1 protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

RIZ1 Protein, an S-adenosyl-L-methionine-dependent histone methyltransferase, specifically methylates 'Lys-9' of histone H3. Additionally, it acts as a DNA-binding transcription factor, showing affinity for the MTE within the HMOX1 gene. Implicated as a potential activator, RIZ1 suggests a regulatory role in HMOX1 gene expression beyond histone modification. RIZ1 Protein, Human (GST) is the recombinant human-derived RIZ1 protein, expressed by E. coli , with N-GST labeled tag.

Background

RIZ1 protein serves as an S-adenosyl-L-methionine-dependent histone methyltransferase, demonstrating specificity in methylating 'Lys-9' of histone H3. Beyond its histone modification role, RIZ1 may also function as a DNA-binding transcription factor, with an affinity for the macrophage-specific TPA-responsive element (MTE) within the HMOX1 (heme oxygenase 1) gene. In this context, it is implicated as a potential transcriptional activator for HMOX1, suggesting a regulatory role in the expression of this gene.

Species

Human

Source

E. coli

Tag

N-GST

Accession

Q13029 (M1-A200)

Gene ID
Molecular Construction
N-term
GST
RIZ1 (M1-A200)
Accession # Q13029
C-term
Protein Length

Partial

Synonyms
PR domain zinc finger protein 2; MTB-ZF; Zinc finger protein RIZ; PRDM2; KMT8; RIZ
AA Sequence

MNQNTTEPVAATETLAEVPEHVLRGLPEEVRLFPSAVDKTRIGVWATKPILKGKKFGPFVGDKKKRSQVKNNVYMWEVYYPNLGWMCIDATDPEKGNWLRYVNWACSGEEQNLFPLEINRAIYYKTLKPIAPGEELLVWYNGEDNPEIAAAIEEERASARSKRSSPKSRKGKKKSQENKNKGNKIQDIQLKTSEPDFTSA

Predicted Molecular Mass
49.6 kDa
Molecular Weight

Approximately 50 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 85%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

RIZ1 Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

RIZ1 Protein, Human (GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RIZ1 Protein, Human (GST)
Cat. No.:
HY-P76580
Quantity:
MCE Japan Authorized Agent: