RIZ1 Protein, Human
RIZ1 Protein, an S-adenosyl-L-methionine-dependent histone methyltransferase, specifically methylates 'Lys-9' of histone H3. Additionally, it acts as a DNA-binding transcription factor, showing affinity for the MTE within the HMOX1 gene. Implicated as a potential activator, RIZ1 suggests a regulatory role in HMOX1 gene expression beyond histone modification. RIZ1 Protein, Human is the recombinant human-derived RIZ1 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
RIZ1 Protein, an S-adenosyl-L-methionine-dependent histone methyltransferase, specifically methylates 'Lys-9' of histone H3. Additionally, it acts as a DNA-binding transcription factor, showing affinity for the MTE within the HMOX1 gene. Implicated as a potential activator, RIZ1 suggests a regulatory role in HMOX1 gene expression beyond histone modification. RIZ1 Protein, Human is the recombinant human-derived RIZ1 protein, expressed by E. coli , with tag free.
RIZ1 protein serves as an S-adenosyl-L-methionine-dependent histone methyltransferase, demonstrating specificity in methylating 'Lys-9' of histone H3. Beyond its histone modification role, RIZ1 may also function as a DNA-binding transcription factor, with an affinity for the macrophage-specific TPA-responsive element (MTE) within the HMOX1 (heme oxygenase 1) gene. In this context, it is implicated as a potential transcriptional activator for HMOX1, suggesting a regulatory role in the expression of this gene.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q13029 (M1-A200)
-
Molecular Construction
-
N-term
-
RIZ1 (M1-A200)
Accession # Q13029 -
C-term
-
-
Protein Length
Partial
-
Synonyms
PR domain zinc finger protein 2; MTB-ZF; Zinc finger protein RIZ; PRDM2; KMT8; RIZ
-
AA Sequence
MNQNTTEPVAATETLAEVPEHVLRGLPEEVRLFPSAVDKTRIGVWATKPILKGKKFGPFVGDKKKRSQVKNNVYMWEVYYPNLGWMCIDATDPEKGNWLRYVNWACSGEEQNLFPLEINRAIYYKTLKPIAPGEELLVWYNGEDNPEIAAAIEEERASARSKRSSPKSRKGKKKSQENKNKGNKIQDIQLKTSEPDFTSA
-
Predicted Molecular Mass
23 kDa
-
Molecular Weight
Approximately 26 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
