Rnase 3 Protein, Human (HEK293, His)
Based on 1 Customer Validation
Rnase 3 Protein, Human (HEK293, His) is the recombinant human-derived Rnase 3 protein, expressed by HEK293, with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Rnase 3 Protein, Human (HEK293, His) is the recombinant human-derived Rnase 3 protein, expressed by HEK293, with C-6*His labeled tag.
Background
Rnase 3 is a cytotoxin and helminthotoxin with low-efficiency ribonuclease activity. It exhibits a wide range of biological activities, including antibacterial effects, preferentially targeting Gram-negative strains but also affecting Gram-positive strains by causing cytoplasmic membrane depolarization. Additionally, it promotes outer membrane detachment in E.coli, alters overall cell shape, and leads to partial loss of cellular content.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
AAH96060.1 (R28-I160)
-
Molecular Construction
-
N-term
-
Rnase 3 (R28-I160)
Accession # AAH96060.1 -
6*His
-
C-term
-
-
Protein Length
Full Length of Eosinophil cationic protein Chain
-
Synonyms
RNASE3; RAF1; Prev. RNS3; Ribonuclease 3; ECP; RNase 3; Eosinophil Cationic Protein; Cytotoxic Ribonuclease; Ribonuclease A Family Member 3; Ribonuclease, RNase A Family, 3
-
AA Sequence
RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCRYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI
-
Predicted Molecular Mass
16.6 kDa
-
Molecular Weight
Approximately 25-35 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris HCl, 150 mM NaCl, 1 mM DTT, 10% Glycerol, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
