ROR1 Protein, Mouse (Biotinylated, HEK293, His-Avi)
ROR1 protein shows minimal kinase activity in vitro, indicating an improbable role as a tyrosine kinase in vivo. It functions as a receptor for WNT5A, activating NFkB signaling and potentially inhibiting WNT3A signaling. Additionally, ROR1 plays a vital role in the inner ear, aiding the innervation of auditory hair cells by spiral ganglion neurons. ROR1, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived ROR1 protein, expressed by HEK293, with N-Avi labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ROR1 protein shows minimal kinase activity in vitro, indicating an improbable role as a tyrosine kinase in vivo. It functions as a receptor for WNT5A, activating NFkB signaling and potentially inhibiting WNT3A signaling. Additionally, ROR1 plays a vital role in the inner ear, aiding the innervation of auditory hair cells by spiral ganglion neurons. ROR1, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived ROR1 protein, expressed by HEK293, with N-Avi labeled tag.
Background
ROR1 protein exhibits very low kinase activity in vitro, suggesting an unlikely role as a tyrosine kinase in vivo. It serves as a receptor for the ligand WNT5A, activating downstream NFkB signaling pathways and potentially inhibiting WNT3A-mediated signaling. Notably, ROR1 plays a crucial role in the inner ear, particularly in facilitating the innervation of auditory hair cells by spiral ganglion neurons.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-Avi;C-His
-
Accession
Q9Z139 (Q30-E403)
-
Gene ID26563
-
Molecular Construction
-
N-term
-
ROR1 (Q30-Y403)
Accession # Q9Z139 -
His-Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
ROR1; Neurotrophic Tyrosine Kinase, Receptor-Related 1; Prev. NTRKR1; DJ537F10.1; Inactive Tyrosine-Protein Kinase Transmembrane Receptor ROR1; Receptor Tyrosine Kinase Like Orphan Receptor 1; ROR1 Protein
-
AA Sequence
QETELSVSAELVPTSSWNTSSEIDKGSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPSIRWFKNDAPVVQEPRRISFRATNYGSRLRIRNLDTTDTGYFQCVATNGKKVVSTTGVLFVKFGPPPTASPGSSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEVLENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHSFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME
-
Predicted Molecular Mass
45.4 kDa
-
Molecular Weight
Approximately 58-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
