RORa Protein, Human (sf9)

The RORa protein is a nuclear receptor that is critical for a variety of physiological processes including development, immunity, circadian rhythms, and metabolic pathways. RORa operates as a monomer, binding DNA to RORE and exhibiting intrinsic transcriptional activity. RORa Protein, Human (sf9) is the recombinant human-derived RORa protein, expressed by sf9 insect cells , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Biological Activity
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The RORa protein is a nuclear receptor that is critical for a variety of physiological processes including development, immunity, circadian rhythms, and metabolic pathways. RORa operates as a monomer, binding DNA to RORE and exhibiting intrinsic transcriptional activity. RORa Protein, Human (sf9) is the recombinant human-derived RORa protein, expressed by sf9 insect cells , with tag free.

Background

RORa Protein, a nuclear receptor, functions as a key regulator in diverse physiological processes, including embryonic development, cellular differentiation, immunity, circadian rhythm, and metabolism of lipids, steroids, xenobiotics, and glucose. Operating as a monomer, RORa binds DNA to ROR response elements (RORE) and exhibits intrinsic transcriptional activity. Natural ligands like oxysterols act as agonists or inverse agonists, modulating its transcriptional activity. RORa recruits distinct cofactor combinations to target gene regulatory regions, modulating their expression depending on tissue, time, and promoter contexts. Its regulatory influence extends to genes involved in photoreceptor and skeletal muscle development, cerebellum development, granule cell proliferation, calcium-mediated signal transduction, and circadian expression of clock genes. In the liver, RORa, along with RORC, acts as a positive or negative modulator of lipid, steroid, and xenobiotic metabolism genes. It also plays a role in hepatic glucose metabolism and adipocyte differentiation regulation. Moreover, RORa is implicated in CD4(+) T-helper cell lineage specification into T(H)17 cells, inhibits NF-kappa-B signaling, and interacts with HIF1A in hypoxia signaling. The multifaceted interactions of RORa with various cofactors and regulatory elements underscore its versatile role in orchestrating complex biological processes.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • RORa (A271-G523)
      Accession # P35398
    • C-term
  • Protein Length

    Partial

  • Synonyms

    RORA; RAR-Related Orphan Nuclear Receptor Alpha; RAR Related Orphan Receptor A; RAR-Related Orphan Receptor A; NR1F1; Nuclear Receptor RZR-Alpha; RZRA; Retinoic Acid Receptor-Related Orphan Receptor Alpha; Nuclear Receptor Subfamily 1 Group F Member 1; RA

  • AA Sequence

    AELEHLAQNISKSHLETCQYLREELQQITWQTFLQEEIENYQNKQREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQNDQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPDVFKSLGCEDFISFVFEFGKSLCSMHLTEDEIALFSAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRALCGRHTEKLMAFKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00