RORC Protein, Human (His, SUMO)

Customer Review

Based on 1 Customer Validation

RORC Protein, Human (His, SUMO) is the recombinant human-derived RORC, expressed by E. coli , with N-6*His, N-SUMO labeled tag. ,

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

RORC Protein, Human (His, SUMO) is the recombinant human-derived RORC, expressed by E. coli , with N-6*His, N-SUMO labeled tag. ,

Background

ROR gamma T is a nuclear receptor that binds as a monomer to ROR response elements (ROREs) containing a single core motif half-site 5'-AGGTCA-3' preceded by a short A-T-rich sequence. It serves as a key regulator of cellular differentiation, immunity, peripheral circadian rhythm, and the metabolism of lipids, steroids, xenobiotics, and glucose. The receptor exhibits intrinsic transcriptional activity and interacts with natural ligands such as oxysterols (e.g., 25-hydroxycholesterol as an agonist and 7-oxygenated sterols as inverse agonists), which modulate its transcriptional output. Depending on tissue, temporal, and promoter contexts, ROR gamma T recruits distinct cofactor combinations to target gene regulatory regions to fine-tune their expression. It competes with NR1D1 for binding to shared DNA response elements on clock genes (e.g., BMAL1, CRY1, NR1D1), driving circadian oscillations in peripheral tissues. Additionally, it regulates adipocyte differentiation, hepatocyte glucose metabolism, and IFN-gamma-dependent anti-mycobacterial immunity. It is essential for thymopoiesis, secondary lymphoid tissue development (e.g., lymph nodes, Peyer's patches), and the differentiation of Th17 cells, where it synergizes with RORA to antagonize the Th1 program.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His;N-SUMO
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His-SUMO
    • P51449-1 (M1-K518)
      Accession # RORC
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    RORC; Retinoid-Related Orphan Receptor Gamma; RAR Related Orphan Receptor C; Nuclear Receptor RZR-Gamma; NR1F3; RAR-Related Orphan Nuclear Receptor Variant 2; RZRG; Retinoid-Related Orphan Receptor-Gamma; RORG; Retinoic Acid-Binding Receptor Gamma; RAR-Re

  • AA Sequence

    MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQRQQQQQEPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKASGSGPSYSNNLAKAGLNGASCHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFSTETESPVGLSK

  • Predicted Molecular Mass

    74.2 kDa

  • Molecular Weight

    Approximately 76 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00