RPE Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

RPE proteins play a key role in cellular metabolism by catalyzing the reversible epimerization of D-ribulose 5-phosphate to D-xylulose 5-phosphate. This enzyme activity is a key step in the non-oxidative phase of the pentose phosphate pathway and promotes the interconversion of pentose phosphates. RPE Protein, Mouse (HEK293, His) is the recombinant mouse-derived RPE protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

RPE proteins play a key role in cellular metabolism by catalyzing the reversible epimerization of D-ribulose 5-phosphate to D-xylulose 5-phosphate. This enzyme activity is a key step in the non-oxidative phase of the pentose phosphate pathway and promotes the interconversion of pentose phosphates. RPE Protein, Mouse (HEK293, His) is the recombinant mouse-derived RPE protein, expressed by HEK293 , with C-His labeled tag.

Background

Ribulose-5-phosphate epimerase (RPE) is an enzyme that catalyzes the reversible epimerization of D-ribulose 5-phosphate to D-xylulose 5-phosphate. This enzymatic activity is a key step in the non-oxidative phase of the pentose phosphate pathway, a metabolic pathway essential for the interconversion of sugars and the generation of pentose phosphates. The reversible conversion of ribulose 5-phosphate to xylulose 5-phosphate by RPE contributes to the synthesis of various important cellular components, including nucleotides and coenzymes. The intricate regulation of the pentose phosphate pathway, facilitated by enzymes like RPE, ensures a balanced supply of ribose-5-phosphate for nucleotide biosynthesis and NADPH for redox reactions within the cell. Understanding the functions of RPE provides insights into the regulation of sugar metabolism and its significance in cellular processes.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • RPE (M1-R228)
      Accession # Q8VEE0
    • His
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    RPE; Ribulose-Phosphate 3-Epimerase; Ribulose-5-Phosphate-3-Epimerase; RPE2-1

  • AA Sequence

    MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSRPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTTVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPTLDIEVDGGVGPDTVQKCAEAGANMIVSGSAIMRSDDPRAVINLLRNVCSEAAQKRSLDR

  • Molecular Weight

    Approximately 27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00