S100A1 Protein, Human (HEK293, hFc)
Based on 1 Customer Validation
The S100A1 gene encodes a protein that regulates cellular processes, with potential roles in Ca2+ release, microtubule assembly, and protein phosphorylation. Decreased expression is linked to cardiomyopathies, highlighting its importance in heart-related conditions. It is abundantly expressed in the heart, salivary gland, and other tissues. S100A1 Protein, Human (HEK293, hFc) is the recombinant human-derived S100A1 protein, expressed by HEK293 , with N-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The S100A1 gene encodes a protein that regulates cellular processes, with potential roles in Ca2+ release, microtubule assembly, and protein phosphorylation. Decreased expression is linked to cardiomyopathies, highlighting its importance in heart-related conditions. It is abundantly expressed in the heart, salivary gland, and other tissues. S100A1 Protein, Human (HEK293, hFc) is the recombinant human-derived S100A1 protein, expressed by HEK293 , with N-hFc labeled tag.
Background
The S100A1 gene encodes a protein that belongs to the S100 family, characterized by 2 EF-hand calcium-binding motifs. S100 proteins are distributed in the cytoplasm and/or nucleus of various cells, playing roles in the regulation of cellular processes like cell cycle progression and differentiation. With at least 13 members located in a cluster on chromosome 1q21, this protein may be involved in stimulating Ca2+-induced Ca2+ release, inhibiting microtubule assembly, and impeding protein kinase C-mediated phosphorylation. Notably, decreased expression of S100A1 has been associated with cardiomyopathies, emphasizing its potential significance in heart-related conditions. The gene exhibits biased expression, particularly abundant in the heart, salivary gland, and select other tissues.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. When Recombinant Human S100A1 is immobilize at 1 μg/mL, 100 μL/well, it binds recombinant human HSP70/HSPA1A with the ED50 value of 2.259 μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-hFc
-
Accession
NP_006262.1 (G2-S94)
-
Molecular Construction
-
N-term
-
hFc
-
S100A1 (G2-S94)
Accession # NP_006262.1 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
S100A1; Protein S100-A1; Prev. S100A; S100 Calcium-Binding Protein; S100-Alpha; Protein S100; S100 Calcium-Binding Protein A1; S100 Alpha; S-100 Protein Subunit Alpha; S100; S-100 Protein Alpha Chain; S100 Calcium Binding Protein A1; S100 Protein, Alpha P
-
AA Sequence
GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
-
Molecular Weight
Approximately 40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 10 mM NaCl, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
