1. Recombinant Proteins
  2. Others
  3. S100A1 Protein, Mouse (His)

S100A1 is a small calcium-binding protein that plays an important regulatory role in Ca(2+) homeostasis, chondrocyte biology, and cardiomyocyte function.In response to elevated intracellular Ca(2+) levels, S100A1 undergoes conformational changes and interacts with key proteins in cardiomyocytes, such as RYR1, RYR2, ATP2A2, and F1-ATPase.S100A1 Protein, Mouse (His) is the recombinant mouse-derived S100A1 protein, expressed by E.coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
10 μg Get quote
50 μg Get quote
100 μg Get quote

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

S100A1 is a small calcium-binding protein that plays an important regulatory role in Ca(2+) homeostasis, chondrocyte biology, and cardiomyocyte function.In response to elevated intracellular Ca(2+) levels, S100A1 undergoes conformational changes and interacts with key proteins in cardiomyocytes, such as RYR1, RYR2, ATP2A2, and F1-ATPase.S100A1 Protein, Mouse (His) is the recombinant mouse-derived S100A1 protein, expressed by E.coli , with N-His labeled tag.

Background

S100A1 is a small calcium-binding protein that plays pivotal roles in various biological processes, including the regulation of Ca(2+) homeostasis, chondrocyte biology, and cardiomyocyte function. In response to elevated intracellular Ca(2+) levels, S100A1 undergoes conformational changes, enabling interactions with specific target proteins and modulating their activities. In cardiomyocytes, it orchestrates a network that governs sarcoplasmic reticulum Ca(2+) cycling and mitochondrial function by interacting with key proteins such as ryanodine receptors RYR1 and RYR2, sarcoplasmic reticulum Ca(2+)-ATPase/ATP2A2, and mitochondrial F1-ATPase. This multifaceted protein contributes to diastolic Ca(2+) dissociation and myofilament mechanics, enhancing relaxation during diastole. S100A1 forms dimers of either two alpha chains, two beta chains, or one of each, and it also engages in heterodimeric interactions with S100P. Additionally, it interacts with various proteins such as AGER, CAPZA1, FKBP4, RYR1, RYR2, CACYBP, PPP5C, ATP2A2, PLN, ATP5F1A, and ATP5F1B, participating in diverse cellular processes in a calcium-dependent manner.

Species

Mouse

Source

E. coli

Tag

N-10*His

Accession

P56565 (G2-S94)

Gene ID
Molecular Construction
N-term
10*His
S100A1 (G2-S94)
Accession # P56565
C-term
Protein Length

Full length

Synonyms
Protein S100-A1; S-100 protein alpha chain; S100A; S100A1; S100-alpha
AA Sequence

GSELESAMETLINVFHAHSGQEGDKYKLSKKELKDLLQTELSGFLDVQKDADAVDKVMKELDENGDGEVDFKEYVVLVAALTVACNNFFWETS

Predicted Molecular Mass
11.7 kDa
Molecular Weight

Approximately 11 kDa,based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

S100A1 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

S100A1 Protein, Mouse (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
S100A1 Protein, Mouse (His)
Cat. No.:
HY-P74587
Quantity:
MCE Japan Authorized Agent: