S100A1 Protein, Mouse (His)

Customer Review

Based on 1 Customer Validation

S100A1 is a small calcium-binding protein that plays an important regulatory role in Ca(2+) homeostasis, chondrocyte biology, and cardiomyocyte function.In response to elevated intracellular Ca(2+) levels, S100A1 undergoes conformational changes and interacts with key proteins in cardiomyocytes, such as RYR1, RYR2, ATP2A2, and F1-ATPase.S100A1 Protein, Mouse (His) is the recombinant mouse-derived S100A1 protein, expressed by E.coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

S100A1 is a small calcium-binding protein that plays an important regulatory role in Ca(2+) homeostasis, chondrocyte biology, and cardiomyocyte function.In response to elevated intracellular Ca(2+) levels, S100A1 undergoes conformational changes and interacts with key proteins in cardiomyocytes, such as RYR1, RYR2, ATP2A2, and F1-ATPase.S100A1 Protein, Mouse (His) is the recombinant mouse-derived S100A1 protein, expressed by E.coli , with N-His labeled tag.

Background

S100A1 is a small calcium-binding protein that plays pivotal roles in various biological processes, including the regulation of Ca(2+) homeostasis, chondrocyte biology, and cardiomyocyte function. In response to elevated intracellular Ca(2+) levels, S100A1 undergoes conformational changes, enabling interactions with specific target proteins and modulating their activities. In cardiomyocytes, it orchestrates a network that governs sarcoplasmic reticulum Ca(2+) cycling and mitochondrial function by interacting with key proteins such as ryanodine receptors RYR1 and RYR2, sarcoplasmic reticulum Ca(2+)-ATPase/ATP2A2, and mitochondrial F1-ATPase. This multifaceted protein contributes to diastolic Ca(2+) dissociation and myofilament mechanics, enhancing relaxation during diastole. S100A1 forms dimers of either two alpha chains, two beta chains, or one of each, and it also engages in heterodimeric interactions with S100P. Additionally, it interacts with various proteins such as AGER, CAPZA1, FKBP4, RYR1, RYR2, CACYBP, PPP5C, ATP2A2, PLN, ATP5F1A, and ATP5F1B, participating in diverse cellular processes in a calcium-dependent manner.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilize Mouse S100A1 at 2 μg/mL (100 μL/well) can binds Biotinylated human AGER, The ED50 for this effect is 0.088 μg/mL.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 10*His
    • S100A1 (G2-S94)
      Accession # P56565
    • C-term
  • Protein Length

    Full length

  • Synonyms

    S100A1; Protein S100-A1; Prev. S100A; S100 Calcium-Binding Protein; S100-Alpha; Protein S100; S100 Calcium-Binding Protein A1; S100 Alpha; S-100 Protein Subunit Alpha; S100; S-100 Protein Alpha Chain; S100 Calcium Binding Protein A1; S100 Protein, Alpha P

  • AA Sequence

    GSELESAMETLINVFHAHSGQEGDKYKLSKKELKDLLQTELSGFLDVQKDADAVDKVMKELDENGDGEVDFKEYVVLVAALTVACNNFFWETS

  • Predicted Molecular Mass

    11.7 kDa

  • Molecular Weight

    Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00