S100A9 Protein, Cynomolgus (His)
The S100A9 protein is a calcium and zinc binder that plays a critical regulatory role in inflammation and immune responses. Its diverse functions include induction of neutrophil chemotaxis, adhesion, enhanced bactericidal activity through SYK, PI3K/AKT and ERK1/2 activation, and promotion of phagocytosis. S100A9 Protein, Cynomolgus (His) is the recombinant cynomolgus-derived S100A9 protein, expressed by E. coli , with N-His labeled tag.
- Species: Cynomolgus
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The S100A9 protein is a calcium and zinc binder that plays a critical regulatory role in inflammation and immune responses. Its diverse functions include induction of neutrophil chemotaxis, adhesion, enhanced bactericidal activity through SYK, PI3K/AKT and ERK1/2 activation, and promotion of phagocytosis. S100A9 Protein, Cynomolgus (His) is the recombinant cynomolgus-derived S100A9 protein, expressed by E. coli , with N-His labeled tag.
Background
S100A9, a calcium- and zinc-binding protein, plays a pivotal role in regulating inflammatory processes and immune responses. Its diverse functions include inducing neutrophil chemotaxis, adhesion, and enhancing the bactericidal activity of neutrophils through SYK, PI3K/AKT, and ERK1/2 activation, as well as promoting phagocytosis. Often found in the form of calprotectin (S100A8/A9), it serves intra- and extracellular roles, including facilitating leukocyte arachidonic acid trafficking and NADPH-oxidase activation intracellularly. Extracellularly, it exhibits pro-inflammatory, antimicrobial, oxidant-scavenging, and apoptosis-inducing activities, recruiting leukocytes, promoting cytokine and chemokine production, and regulating leukocyte adhesion and migration. Functioning as an alarmin or DAMP molecule, S100A9 stimulates innate immune cells via Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER), activating MAP-kinase and NF-kappa-B signaling pathways. With antimicrobial activity against bacteria and fungi, it likely acts by chelating Zn(2+), essential for microbial growth. S100A9 can induce cell death through autophagy and apoptosis via mitochondrial-lysosomal cross-talk involving BNIP3 and regulates neutrophil number and apoptosis, acting as an anti-apoptotic factor. Its role as an oxidant scavenger protects against tissue damage by scavenging oxidants. Notably, S100A9 can act as a potent amplifier of inflammation in autoimmunity, cancer development, and tumor spread. It also exhibits transnitrosylase activity, contributing to S-nitrosylation of various targets, and forms complexes with other proteins, such as the iNOS-S100A8/A9 transnitrosylase complex, indicating its multifaceted involvement in immune regulation and inflammatory responses.
Technical Parameters
-
Species Cynomolgus
-
Source E. coli
-
Tag N-His
-
Accession
XP_005541846.1 (M1-R114)
-
Molecular Construction
-
N-term
-
His
-
S100A9 (M1-R114)
Accession # XP_005541846.1 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
S100A9; 60B8AG; Prev. CAGB; CGLB; Prev. CFAG; MIF; MRP-14; NIF; MRP14; Protein S100-A9; P14; Calgranulin B; Migration Inhibitory Factor-Related Protein 14; S100 Calcium-Binding Protein A9 (Calgranulin B); Leukocyte L1 Complex Heavy Chain; S100 Calcium-Bin
-
AA Sequence
MSCKMSQLERNIETIINTFHQYSVKLGHPDTLNRREFKQLVEKDLQNFLKKEKKNDKIIDHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEDDEGPGHHHKPGLGEDAR
-
Predicted Molecular Mass
14.7 kDa
-
Molecular Weight
Approximately 15 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)