1. Recombinant Proteins
  2. Others
  3. S100A9 Protein, Cynomolgus (His)

The S100A9 protein is a calcium and zinc binder that plays a critical regulatory role in inflammation and immune responses. Its diverse functions include induction of neutrophil chemotaxis, adhesion, enhanced bactericidal activity through SYK, PI3K/AKT and ERK1/2 activation, and promotion of phagocytosis. S100A9 Protein, Cynomolgus (His) is the recombinant cynomolgus-derived S100A9 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The S100A9 protein is a calcium and zinc binder that plays a critical regulatory role in inflammation and immune responses. Its diverse functions include induction of neutrophil chemotaxis, adhesion, enhanced bactericidal activity through SYK, PI3K/AKT and ERK1/2 activation, and promotion of phagocytosis. S100A9 Protein, Cynomolgus (His) is the recombinant cynomolgus-derived S100A9 protein, expressed by E. coli , with N-His labeled tag.

Background

S100A9, a calcium- and zinc-binding protein, plays a pivotal role in regulating inflammatory processes and immune responses. Its diverse functions include inducing neutrophil chemotaxis, adhesion, and enhancing the bactericidal activity of neutrophils through SYK, PI3K/AKT, and ERK1/2 activation, as well as promoting phagocytosis. Often found in the form of calprotectin (S100A8/A9), it serves intra- and extracellular roles, including facilitating leukocyte arachidonic acid trafficking and NADPH-oxidase activation intracellularly. Extracellularly, it exhibits pro-inflammatory, antimicrobial, oxidant-scavenging, and apoptosis-inducing activities, recruiting leukocytes, promoting cytokine and chemokine production, and regulating leukocyte adhesion and migration. Functioning as an alarmin or DAMP molecule, S100A9 stimulates innate immune cells via Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER), activating MAP-kinase and NF-kappa-B signaling pathways. With antimicrobial activity against bacteria and fungi, it likely acts by chelating Zn(2+), essential for microbial growth. S100A9 can induce cell death through autophagy and apoptosis via mitochondrial-lysosomal cross-talk involving BNIP3 and regulates neutrophil number and apoptosis, acting as an anti-apoptotic factor. Its role as an oxidant scavenger protects against tissue damage by scavenging oxidants. Notably, S100A9 can act as a potent amplifier of inflammation in autoimmunity, cancer development, and tumor spread. It also exhibits transnitrosylase activity, contributing to S-nitrosylation of various targets, and forms complexes with other proteins, such as the iNOS-S100A8/A9 transnitrosylase complex, indicating its multifaceted involvement in immune regulation and inflammatory responses.

Species

Cynomolgus

Source

E. coli

Tag

N-His

Accession

XP_005541846.1 (M1-R114)

Gene ID
Molecular Construction
N-term
His
S100A9 (M1-R114)
Accession # XP_005541846.1
C-term
Protein Length

Full Length

Synonyms
S100-A9; Calgranulin-B; Calprotectin L1H subunit; MRP-14; p14; CAGB; MRP14
AA Sequence

MSCKMSQLERNIETIINTFHQYSVKLGHPDTLNRREFKQLVEKDLQNFLKKEKKNDKIIDHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEDDEGPGHHHKPGLGEDAR

Predicted Molecular Mass
14.7 kDa
Molecular Weight

Approximately 14.7 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

S100A9 Protein, Cynomolgus (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

S100A9 Protein, Cynomolgus (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
S100A9 Protein, Cynomolgus (His)
Cat. No.:
HY-P77829
Quantity:
MCE Japan Authorized Agent: