S100G Protein, Human (His, Strep)
S100G Protein, Human (His, Strep) is the recombinant human-derived S100G, expressed by E. coli , with Strep, His labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
S100G Protein, Human (His, Strep) is the recombinant human-derived S100G, expressed by E. coli , with Strep, His labeled tag. ,
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Strep;His
-
Accession
P29377 (M1-Q79)
-
Gene ID795
-
Protein Length
Full Length
-
Synonyms
S100G; Protein S100-G; Prev. CALB3; CABP; CABP9K; S100 Calcium-Binding Protein G; CABP1; Calbindin D9K; Calbindin 3, (Vitamin D-Dependent Calcium-Binding Protein); Calbindin-D9k; Vitamin D-Dependent Calcium-Binding Protein, Intestinal; S100D; S100 Calcium
-
AA Sequence
MSTKKSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPSLLKGPNTLDDLFQELDKNGDGEVSFEEFQVLVKKISQ
-
Predicted Molecular Mass
12.3 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
