S100P Protein, Human (His)
Based on 1 publication(s) in Google Scholar
The S100P protein is a multifunctional calcium sensor that actively contributes to cellular calcium signaling. It interacts calcium-dependently with proteins such as EZR and PPP5C, indirectly affecting processes such as microvilli formation. S100P Protein, Human (His) is the recombinant human-derived S100P protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The S100P protein is a multifunctional calcium sensor that actively contributes to cellular calcium signaling. It interacts calcium-dependently with proteins such as EZR and PPP5C, indirectly affecting processes such as microvilli formation. S100P Protein, Human (His) is the recombinant human-derived S100P protein, expressed by E. coli , with N-6*His labeled tag.
The S100P Protein exhibits a multifaceted role as a calcium sensor, actively contributing to cellular calcium signaling. In a calcium-dependent manner, it engages in interactions with various proteins, including EZR and PPP5C, thereby indirectly participating in physiological processes such as the formation of microvilli in epithelial cells. Notably, S100P may stimulate cell proliferation through autocrine activation of the receptor for activated glycation end products (RAGE). Existing as a homodimer and forming heterodimers with S100A1, S100P also interacts with S100PBP and S100Z, and in a calcium-dependent manner, associates with CACYBP. The dimeric form of S100P binds to and activates EZR/Ezrin by revealing its F-actin binding sites, while its calcium-dependent interaction with PPP5C modulates PPP5C activity, providing further insight into the diverse regulatory roles of S100P in cellular processes.
Immobilized Human S100P at 2 μg/mL (100 μL/well) can bind S100P antibody. The ED50 for this effect is 1-3 ng/mL.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Cell Signal
Molecular mechanism of S100P promotes hepatocellular carcinoma by regulating MYBL2-mediated transcription of AURKB. [Abstract]2026 Jul:143:112490. PMID: 41856224
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P25815 (T2-K95)
-
Molecular Construction
-
N-term
-
6*His
-
S100P (T2-K95)
Accession # P25815 -
C-term
-
-
Protein Length
Partial
-
Synonyms
S100P; Protein S100-P; S100 Calcium Binding Protein P; Protein S100-E; Migration-Inducing Gene 9 Protein; MIG9; S100 Calcium-Binding Protein P; S100E
-
AA Sequence
TELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK
-
Predicted Molecular Mass
11.1 kDa
-
Molecular Weight
Approximately 12 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of 20 mM PB,150 mM NaCl, pH 7.0 or PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
