S100P Protein, Human (N-His)

The S100P protein is a multifunctional calcium sensor that actively contributes to cellular calcium signaling. It interacts calcium-dependently with proteins such as EZR and PPP5C, indirectly affecting processes such as microvilli formation. S100P Protein, Human (N-His) is the recombinant human-derived S100P protein, expressed by E. coli , with N-6*His labeled tag. The total length of S100P Protein, Human (N-His) is 94 a.a., with molecular weight of ~11.57 kDa.

The S100P Protein exhibits a multifaceted role as a calcium sensor, actively contributing to cellular calcium signaling. In a calcium-dependent manner, it engages in interactions with various proteins, including EZR and PPP5C, thereby indirectly participating in physiological processes such as the formation of microvilli in epithelial cells. Notably, S100P may stimulate cell proliferation through autocrine activation of the receptor for activated glycation end products (RAGE). Existing as a homodimer and forming heterodimers with S100A1, S100P also interacts with S100PBP and S100Z, and in a calcium-dependent manner, associates with CACYBP. The dimeric form of S100P binds to and activates EZR/Ezrin by revealing its F-actin binding sites, while its calcium-dependent interaction with PPP5C modulates PPP5C activity, providing further insight into the diverse regulatory roles of S100P in cellular processes.

Data is not available

Human

E. coli

N-6*His

P25815 (T2-K95)

6286  [NCBI]

TELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK

Approximately 11.57 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB,150 mM NaCl, pH 7.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.