Copy Link Print Information

SARS-CoV-2 Plpro/Papain-like protease Protein (His)

Customer Review

Based on 1 Customer Validation

SARS-CoV-2 NSP3 (NSP3) is one of non-structure protein that binds to viral RNA, nucleocapsid protein, as well as other viral proteins, and contributes in polyprotein processing. NSP3 has also an important role in innate immune response antagonism and is responsible for release of NSP1, NSP2, and NSP3 from the N-terminal region of pp1a and pp1ab. SARS-CoV-2 Plpro/Papain-like protease Protein (His) is the recombinant Virus-derived SARS-CoV-2 Plpro/Papain-like protease protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Virus
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • SARS-CoV-2 Plpro/Papain-like protease Protein (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

SARS-CoV-2 NSP3 (NSP3) is one of non-structure protein that binds to viral RNA, nucleocapsid protein, as well as other viral proteins, and contributes in polyprotein processing. NSP3 has also an important role in innate immune response antagonism and is responsible for release of NSP1, NSP2, and NSP3 from the N-terminal region of pp1a and pp1ab. SARS-CoV-2 Plpro/Papain-like protease Protein (His) is the recombinant Virus-derived SARS-CoV-2 Plpro/Papain-like protease protein, expressed by E. coli , with N-His labeled tag.

Background

SARS-CoV-2 NSP3 (NSP3) is one of non-structure protein that binds to viral RNA, nucleocapsid protein, as well as other viral proteins, and contributes in polyprotein processing. NSP3 has also an important role in innate immune response antagonism and is responsible for release of NSP1, NSP2, and NSP3 from the N-terminal region of pp1a and pp1ab. NSP3 plays an important role in stimulating the translation of viral mRNAs which are capped but not polyadenylated, instead terminating in a conserved sequence 'GACC' at the 3' that is recognized by NSP3, which competes with host PABPC1 for EIF4G1 binding. The interaction between NSP3 and host EIF4G1 stabilizes the EIF4E-EIF4G1 interaction, thereby facilitating the initiation of capped mRNA translation[1][2].

Technical Parameters

  • Species Virus
  • Source E. coli
  • Tag N-His
  • Accession

    QVD65746.1 (E1564-V1880)

  • Gene ID
    43740578  [NCBI]
  • Molecular Construction
    • N-term
    • His
    • SARS-CoV-2 Plpro (E1564-V1880)
      Accession # QVD65746.1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    SARS-CoV-2 (2019-nCoV) Plpro/papain-like protease-His Protein

  • AA Sequence

    EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPV

  • Predicted Molecular Mass

    36.8 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris 500 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

References

[1]. Shamsi A, et al. Potential drug targets of SARS-CoV-2: From genomics to therapeutics. Int J Biol Macromol. 2021 Apr 30;177:1-9. [Content Brief]

[2]. Role of Structural and Non-Structural Proteins and Therapeutic Targets of SARS-CoV-2 for COVID-19. Cells. 2021 Apr 6;10(4):821. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • SARS-CoV-2 Plpro/Papain-like protease Protein (His) Product Image
    1/16
  • SARS-CoV-2 Plpro/Papain-like protease Protein (His) Product Image