SARS-CoV-2 Plpro/Papain-like protease Protein (His)

SARS-CoV-2 NSP3 (NSP3) is one of non-structure protein that binds to viral RNA, nucleocapsid protein, as well as other viral proteins, and contributes in polyprotein processing. NSP3 has also an important role in innate immune response antagonism and is responsible for release of NSP1, NSP2, and NSP3 from the N-terminal region of pp1a and pp1ab. SARS-CoV-2 Plpro/Papain-like protease Protein (His) is the recombinant Virus-derived SARS-CoV-2 Plpro/Papain-like protease protein, expressed by E. coli , with N-His labeled tag.

SARS-CoV-2 NSP3 (NSP3) is one of non-structure protein that binds to viral RNA, nucleocapsid protein, as well as other viral proteins, and contributes in polyprotein processing. NSP3 has also an important role in innate immune response antagonism and is responsible for release of NSP1, NSP2, and NSP3 from the N-terminal region of pp1a and pp1ab. NSP3 plays an important role in stimulating the translation of viral mRNAs which are capped but not polyadenylated, instead terminating in a conserved sequence 'GACC' at the 3' that is recognized by NSP3, which competes with host PABPC1 for EIF4G1 binding. The interaction between NSP3 and host EIF4G1 stabilizes the EIF4E-EIF4G1 interaction, thereby facilitating the initiation of capped mRNA translation^[1][2].

Virus

E. coli

N-His

QVD65746.1 (E1564-V1880)

43740578  [NCBI]

Partial

EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPV

Approximately 36.79 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 20 mM Tris 500 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. Shamsi A, et al. Potential drug targets of SARS-CoV-2: From genomics to therapeutics. Int J Biol Macromol. 2021 Apr 30;177:1-9.  [Content Brief]

  [2]. Role of Structural and Non-Structural Proteins and Therapeutic Targets of SARS-CoV-2 for COVID-19. Cells. 2021 Apr 6;10(4):821.  [Content Brief]