SARS-CoV-2 S1 Protein (sf9, His)
The SARS-Cov-2 S glycoprotein is a SARS-Cov-2 S glycoprotein. The amino acid sequence 1261-1267a.a of the SARS-Cov-2 S glycoprotein is transmembrane. The SARS-Cov-2 S glycoprotein is a highly glycosylated trimer, each of which consists of 1260 amino acids (residues 14-1273), divided into four structural domains: the n-terminal domain (NTD), the c-terminal domain (CTD, also known as the receptor-binding domain, RBD), and two subdomains (SD1 and SD2). SARS-CoV-2 S1 Protein (sf9, His) is the recombinant Virus-derived SARS-CoV-2 S1 protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Virus
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The SARS-Cov-2 S glycoprotein is a SARS-Cov-2 S glycoprotein. The amino acid sequence 1261-1267a.a of the SARS-Cov-2 S glycoprotein is transmembrane. The SARS-Cov-2 S glycoprotein is a highly glycosylated trimer, each of which consists of 1260 amino acids (residues 14-1273), divided into four structural domains: the n-terminal domain (NTD), the c-terminal domain (CTD, also known as the receptor-binding domain, RBD), and two subdomains (SD1 and SD2). SARS-CoV-2 S1 Protein (sf9, His) is the recombinant Virus-derived SARS-CoV-2 S1 protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
SARS-Cov-2 is a enveloped positive-sense single-stranded RNA virus that causes COVID-19.
SARS-CoV-2 possesses four structural proteins, namely the envelope protein (E), spike or surface glycoprotein (S), membrane protein (M), and nucleocapsid protein (N).
The SARS-Cov-2 S glycoprotein is located on the exterior of the viral particle, giving the coronavirus its crown-like appearance.
The SARS-Cov-2 S glycoprotein can mediate the attachment and entry of viral particles into host cells and is an important target for vaccine development, antibody therapy, and antigen-based diagnostic esting[1][2][3][4][5].
Technical Parameters
-
Species Virus
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
YP_009724390.1 (V16-R685)
-
Molecular Construction
-
N-term
-
S1 Protein (V16-R685)
Accession # YP_009724390.1 -
His
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
2019-nCov RBD Protein; 2019-nCoV Spike RBD Protein; S protein RBD; 2019-nCoV S protein RBD
-
AA Sequence
VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAR
-
Predicted Molecular Mass
76.5 kDa
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
