Uteroglobin/SCGB1A1 Protein, Mouse (His)
Based on 1 Customer Validation
Uteroglobin/SCGB1A1 protein has multiple binding abilities and can interact with phosphatidylcholine, phosphatidylinositol, PCB, and binds weakly to progesterone.As a potent phospholipase A2 inhibitor, its antiparallel homodimer structure is maintained by disulfide bonds.Uteroglobin/SCGB1A1 Protein, Mouse (His) is the recombinant mouse-derived SCGB1A1 protein, expressed by E.coli , with N-6*His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Uteroglobin/SCGB1A1 protein has multiple binding abilities and can interact with phosphatidylcholine, phosphatidylinositol, PCB, and binds weakly to progesterone.As a potent phospholipase A2 inhibitor, its antiparallel homodimer structure is maintained by disulfide bonds.Uteroglobin/SCGB1A1 Protein, Mouse (His) is the recombinant mouse-derived SCGB1A1 protein, expressed by E.coli , with N-6*His labeled tag.
Background
The Uteroglobin/SCGB1A1 Protein exhibits versatile binding capabilities, interacting with phosphatidylcholine, phosphatidylinositol, polychlorinated biphenyls (PCB), and displaying weak binding to progesterone. Additionally, it acts as a potent inhibitor of phospholipase A2. Structurally, Uteroglobin forms an antiparallel homodimer, held together by disulfide linkages. However, the reported interaction with LMBR1L remains controversial, emphasizing the need for further investigation into this specific molecular association. The multifaceted binding properties of Uteroglobin underscore its potential role in diverse cellular processes, including lipid metabolism and inflammatory responses.
Verified Bioactivity
Measured by the ability of the immobilized protein to affect the adhesion of the A549 human lung carcinoma cells in the presence of Fibronectin. The ED50 for this effect is 1.531 μg/mL, corresponding to a specific activity is 653.17 units/mg.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His
-
Accession
Q06318 (D22-96F)
-
Molecular Construction
-
N-term
-
6*His
-
SCGB1A1 (D22-96F)
Accession # Q06318 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
SCGB1A1; Urinary Protein 1; Prev. UGB; CCPBP; Uteroglobin; UP-1; CC10; UP1; CCSP; Secretoglobin, Family 1A, Member 1 (Uteroglobin); CC16; Uteroglobin (Clara Cell Specific 10-KD Protein); Club Cell Phospholipid-Binding Protein; Uteroglobin (Club-Cell Speci
-
AA Sequence
DICPGFLQVLEALLMESESGYVASLKPFNPGSDLQNAGTQLKRLVDTLPQETRINIMKLTEKILTSPLCKQDLRF
-
Predicted Molecular Mass
8.4 kDa
-
Molecular Weight
Approximately 9 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
