SDF-2 Protein, Mouse (sf9, His)
Based on 1 Customer Validation
SDF-2 protein is ubiquitously expressed, with its highest concentrations observed in liver and kidney tissues.SDF-2 Protein, Mouse (sf9, His) is the recombinant mouse-derived SDF-2 protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Mouse
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
SDF-2 protein is ubiquitously expressed, with its highest concentrations observed in liver and kidney tissues.SDF-2 Protein, Mouse (sf9, His) is the recombinant mouse-derived SDF-2 protein, expressed by Sf9 insect cells , with C-His labeled tag.
SDF-2 protein exhibits ubiquitous expression, with its highest levels found in the liver and kidney tissues.
Technical Parameters
-
Species Mouse
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
Q9DCT5 (M1-L211)
-
Molecular Construction
-
N-term
-
SDF-2 (M1-L211)
Accession # Q9DCT5 -
His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
SDF2; SDF-2; Stromal Cell Derived Factor 2; SDF2 Protein; Stromal Cell-Derived Factor 2
-
AA Sequence
MAVLSLLLLGGLWSAVGASNMAVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKTATVCERGTPIKCGQPIRLTHINTGRNLHSHHFTSPLSGNQEVSAFGEEGEGDYLDDWTVLCNGPYWVRDGEVRFKHSSTDVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEGIFMKPSELLRAEVHHAEL
-
Predicted Molecular Mass
22.8 kDa
-
Molecular Weight
Approximately 27 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.2 μm filtered solution of 20 mM, Tris 500 mM Nacl, 10% glycerol, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (233 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
