SECTM1 Protein, Human (HEK293, hFc)

SECTM1 Protein potentially influences thymocyte signaling, indicating a role in thymic regulatory mechanisms. Its interaction with CD7 suggests involvement in cellular processes, potentially influencing thymocyte-associated signaling pathways. SECTM1's significance in thymocyte function and interaction with CD7 hints at a role in modulating immune responses and cellular communication within the thymic microenvironment. SECTM1 Protein, Human (HEK293, hFc) is the recombinant human-derived SECTM1 protein, expressed by HEK293 , with C-hFc labeled tag.

The SECTM1 protein appears to play a potential role in thymocyte signaling, suggesting its involvement in the complex regulatory mechanisms within the thymus. Its interaction with CD7 further underscores its role in these cellular processes, hinting at a possible influence on the signaling pathways associated with thymocytes. The significance of SECTM1 in the context of thymocyte function and its interaction with CD7 implies a potential role in modulating immune responses and cellular communication within the thymic microenvironment.

Measured by its binding ability in a functional ELISA. Immobilized CD7 at 0.5 μg/well can bind human SECTM1 at 0.076924-1000 ng/mL, the EC₅₀ is 2.034-4.582 ng/mL.

Human

HEK293

C-hFc

Q8WVN6 (Q29-G145)

6398  [NCBI]

Extracellular Domain

QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTG

Approximately 46 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.

• [1]. /biology-dictionary/ball-1-cell.html