SENP3 Protein, Human

The SENP3 protein is a key protease in protein sumoylation and can efficiently release SUMO2 and SUMO3 from substrates but is less active on SUMO1 conjugates. Its regulatory effects span multiple cellular processes, including dissociation of SUMO2 from MEF2D, enhancing its transcriptional activation, and dissociation from CDCA8, affecting cellular dynamics. SENP3 Protein, Human is the recombinant human-derived SENP3 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The SENP3 protein is a key protease in protein sumoylation and can efficiently release SUMO2 and SUMO3 from substrates but is less active on SUMO1 conjugates. Its regulatory effects span multiple cellular processes, including dissociation of SUMO2 from MEF2D, enhancing its transcriptional activation, and dissociation from CDCA8, affecting cellular dynamics. SENP3 Protein, Human is the recombinant human-derived SENP3 protein, expressed by E. coli , with tag free.

Background

SENP3 protein emerges as a pivotal protease in the intricate world of protein sumoylation, exhibiting a potent ability to release SUMO2 and SUMO3 monomers from sumoylated substrates, with weaker activity against SUMO1 conjugates. Its regulatory influence extends to various cellular processes, as SENP3 is involved in deconjugating SUMO2 from MEF2D, enhancing its transcriptional activation potential, and from CDCA8, impacting cellular dynamics. Functioning as a redox sensor, SENP3, when redistributed into the nucleoplasm, acts as an effector to boost HIF1A transcriptional activity by desumoylating EP300. It plays a vital role in rRNA processing through deconjugation of SUMO2 and SUMO3 from nucleophosmin, NPM1, while also participating in the regulation of the sumoylation status of ZNF148. Operating as a component of the Five Friends of Methylated CHTOP (5FMC) complex, SENP3 contributes to the desumoylation of ZNF148, leading to the subsequent transactivation of ZNF148 target genes. Furthermore, SENP3 deconjugates SUMO2 from KAT5 and, under oxidative stress, its degradation is impeded, resulting in its stabilization and accumulation in the nucleoplasm.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • SENP3 (E301-V574)
      Accession # Q9H4L4
    • C-term
  • Protein Length

    Partial

  • Synonyms

    SENP3; SUMO-1-Specific Protease 3; SUMO Specific Peptidase 3; DKFZP586K0919; SSP3; DKFZp762A152; SMT3IP1; SUMO1/Sentrin/SMT3 Specific Protease 3; Ulp1; Sentrin/SUMO-Specific Protease SENP3; SUMO1/Sentrin/SMT3 Specific Peptidase 3; Sentrin/SUMO-Specific Pr

  • AA Sequence

    EKAGQHSPLREEHVTCVQSILDEFLQTYGSLIPLSTDEVVEKLEDIFQQEFSTPSRKGLVLQLIQSYQRMPGNAMVRGFRVAYKRHVLTMDDLGTLYGQNWLNDQVMNMYGDLVMDTVPEKVHFFNSFFYDKLRTKGYDGVKRWTKNVDIFNKELLLIPIHLEVHWSLISVDVRRRTITYFDSQRTLNRRCPKHIAKYLQAEAVKKDRLDFHQGWKGYFKMNVARQNNDSDCGAFVLQYCKHLALSQPFSFTQQDMPKLRRQIYKELCHCKLTV

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00