Serpina1d Protein, Mouse (HEK293)
Based on 1 Customer Validation
The Serpina1d protein is a vigilant sentinel in cellular regulation, acting specifically as an inhibitor of serine proteases, particularly trypsin and chymotrypsin. It effectively blocks their enzymatic activity but appears relatively ineffective against elastase. Serpina1d Protein, Mouse (HEK293) is the recombinant mouse-derived Serpina1d protein, expressed by HEK293 , with tag free.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The Serpina1d protein is a vigilant sentinel in cellular regulation, acting specifically as an inhibitor of serine proteases, particularly trypsin and chymotrypsin. It effectively blocks their enzymatic activity but appears relatively ineffective against elastase. Serpina1d Protein, Mouse (HEK293) is the recombinant mouse-derived Serpina1d protein, expressed by HEK293 , with tag free.
Serpina1d, a vigilant sentinel in the intricate landscape of cellular regulation, assumes the role of an inhibitor with a specialization in serine proteases. Its watchful gaze extends to trypsin and chymotrypsin, where it demonstrates remarkable efficacy in thwarting their enzymatic activities. However, its prowess takes a nuanced turn, displaying a relative inefficacy against elastase. Serpina1d's strategic inhibition of specific serine proteases underscores its significance as a discerning regulator, contributing to the delicate balance of enzymatic activities within cellular environments.
Measured by its ability to inhibit trypsin cleavage of a fluorogenic peptide substrate Mca-Arg-Pro-Lys-Pro-Val-Glu-Nval-Trp-Arg-Lys (DNP)-NH2 and the IC50 value is < 15 nM.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag Tag Free
-
Accession
XP_003945711.1 (E25-K413)
-
Molecular Construction
-
N-term
-
Serpina1d (E25-K413)
Accession # XP_003945711.1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
Alpha-1-antitrypsin 1-4; Serine protease inhibitor 1-4; Serpin A1d; Dom4; Spi1-4
-
AA Sequence
EDVQETDTSQKDQSPASHEIATNLGDFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHKSFQHLLQTLNRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAKKVINDFVEKGTQGKIAEAVKKLDQDTVFALANYILFKGKWKKPFDPENTEEAEFHVDESTTVKVPMMTLSGMLDVHHCSTLSSWVLLMDYAGNATAVFLLPDDGKMQHLEQTLSKELISKFLLNRRRRLAQIHFPRLSISGEYNLKTLMSPLGITRIFNNGADLSGITEENAPLKLSQAVHKAVLTIDETGTEAAAVTVLQMVPMSMPPILRFDHPFLFIIFEEHTQSPIFVGKVVDPTHK
-
Predicted Molecular Mass
44.1 kDa
-
Molecular Weight
Approximately 54 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
