SFTPA1 Protein, Human (HEK293, hFc)
Based on 1 Customer Validation
SFTPA1 (Pulmonary surfactant-associated protein A1) is primarily synthesised in type II alveolar cells in the lung, as part of a complex of lipids and proteins known as pulmonary surfactant. SFTPA1 Protein, Human (HEK293, hFc) is the recombinant human-derived SFTPA1 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
SFTPA1 (Pulmonary surfactant-associated protein A1) is primarily synthesised in type II alveolar cells in the lung, as part of a complex of lipids and proteins known as pulmonary surfactant. SFTPA1 Protein, Human (HEK293, hFc) is the recombinant human-derived SFTPA1 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
In presence of calcium ions, SFTPA1 (Pulmonary surfactant-associated protein A1) binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration. SFTPA1 Can recognize, bind, and opsonize pathogens to enhance their elimination by alveolar macrophages.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
Q8IWL2 (E21-F248)
-
Gene ID653509
-
Protein Length
Full Length of Mature Protein
-
Synonyms
SFTPA1; PSPA; Prev. SFTP1; Surfactant, Pulmonary-Associated Protein A1; COLEC4; Surfactant Protein A1B; SP-A1; SP-A1 Epsilon; SP-A; SP-A1 Delta; 35 KDa Pulmonary Surfactant-Associated Protein; SP-A1 Gamma; Alveolar Proteinosis Protein; SP-A1 Beta; Surfact
-
AA Sequence
EVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPMGPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF
-
Predicted Molecular Mass
53.1 kDa
-
Molecular Weight
Approximately 54-66 kDa, based on SDS-PAGE under reducing condition, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, 6% Trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
