1. Recombinant Proteins
  2. Others
  3. SIAE Protein, Human (sf9, His)

SIAE proteins play a key role in cellular processes by catalyzing the removal of the O-acetyl ester group specifically from the 9-position of the parent sialic acid N-acetylneuraminic acid. Through this enzymatic activity, SIAE helps regulate sialic acid modifications, affecting various biological functions associated with cell surface glycoconjugates. SIAE Protein, Human (sf9, His) is the recombinant human-derived SIAE protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SIAE proteins play a key role in cellular processes by catalyzing the removal of the O-acetyl ester group specifically from the 9-position of the parent sialic acid N-acetylneuraminic acid. Through this enzymatic activity, SIAE helps regulate sialic acid modifications, affecting various biological functions associated with cell surface glycoconjugates. SIAE Protein, Human (sf9, His) is the recombinant human-derived SIAE protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

The SIAE (Sialic Acid Acetylesterase) protein is an enzyme that plays a crucial role in sialic acid metabolism by catalyzing the removal of O-acetyl ester groups from position 9 of the parent sialic acid, N-acetylneuraminic acid. This enzymatic activity is important for regulating the structural modifications of sialic acids, which are essential components of glycoproteins and glycolipids. SIAE-mediated deacetylation at position 9 influences the overall charge and structure of sialic acids, impacting cellular interactions, immune responses, and signal transduction. Understanding the functions of SIAE provides insights into the dynamic regulation of sialic acid modifications and their implications for various physiological processes.

Species

Human

Source

Sf9 insect cells

Tag

C-His

Accession

Q9HAT2-1 (I24-K523)

Gene ID
Molecular Construction
N-term
SIAE (I24-K523)
Accession # Q9HAT2-1
His
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
Sialate O-Acetylesterase; H-Lse; Sialic Acid-Specific 9-O-Acetylesterase; SIAE; YSG2
AA Sequence

IGFRFASYINNDMVLQKEPAGAVIWGFGTPGATVTVTLRQGQETIMKKVTSVKAHSDTWMVVLDPMKPGGPFEVMAQQTLEKINFTLRVHDVLFGDVWLCSGQSNMQMTVLQIFNATRELSNTAAYQSVRILSVSPIQAEQELEDLVAVDLQWSKPTSENLGHGYFKYMSAVCWLFGRHLYDTLQYPIGLIASSWGGTPIEAWSSGRSLKACGVPKQGSIPYDSVTGPSKHSVLWNAMIHPLCNMTLKGVVWYQGESNINYNTDLYNCTFPALIEDWRETFHRGSQGQTERFFPFGLVQLSSDLSKKSSDDGFPQIRWHQTADFGYVPNPKMPNTFMAVAMDLCDRDSPFGSIHPRDKQTVAYRLHLGARALAYGEKNLTFEGPLPEKIELLAHKGLLNLTYYQQIQVQKKDNKIFEISCCSDHRCKWLPASMNTVSTQSLTLAIDSCHGTVVALRYAWTTWPCEYKQCPLYHPSSALPAPPFIAFITDQGPGHQSNVAK

Molecular Weight

Approximately 61 kDa

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 8.0, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SIAE Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

SIAE Protein, Human (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SIAE Protein, Human (sf9, His)
Cat. No.:
HY-P74548
Quantity:
MCE Japan Authorized Agent: