SIAE Protein, Human (sf9, His)

Customer Review

Based on 1 Customer Validation

SIAE proteins play a key role in cellular processes by catalyzing the removal of the O-acetyl ester group specifically from the 9-position of the parent sialic acid N-acetylneuraminic acid. Through this enzymatic activity, SIAE helps regulate sialic acid modifications, affecting various biological functions associated with cell surface glycoconjugates. SIAE Protein, Human (sf9, His) is the recombinant human-derived SIAE protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

SIAE proteins play a key role in cellular processes by catalyzing the removal of the O-acetyl ester group specifically from the 9-position of the parent sialic acid N-acetylneuraminic acid. Through this enzymatic activity, SIAE helps regulate sialic acid modifications, affecting various biological functions associated with cell surface glycoconjugates. SIAE Protein, Human (sf9, His) is the recombinant human-derived SIAE protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

The SIAE (Sialic Acid Acetylesterase) protein is an enzyme that plays a crucial role in sialic acid metabolism by catalyzing the removal of O-acetyl ester groups from position 9 of the parent sialic acid, N-acetylneuraminic acid. This enzymatic activity is important for regulating the structural modifications of sialic acids, which are essential components of glycoproteins and glycolipids. SIAE-mediated deacetylation at position 9 influences the overall charge and structure of sialic acids, impacting cellular interactions, immune responses, and signal transduction. Understanding the functions of SIAE provides insights into the dynamic regulation of sialic acid modifications and their implications for various physiological processes.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • SIAE (I24-K523)
      Accession # Q9HAT2-1
    • His
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    SIAE; MGC87009; Prev. YSG2; Cytosolic Sialic Acid 9-O-Acetylesterase Homolog; CSE-C; Sialic Acid-Specific 9-O-Acetylesterase; LSE; Ysg2 Homolog (Mouse); Sialic Acid-Specific Acetylesterase II; AIS6; Sialate O-Acetylesterase; CSEC; Sialic Acid Acetylestera

  • AA Sequence

    IGFRFASYINNDMVLQKEPAGAVIWGFGTPGATVTVTLRQGQETIMKKVTSVKAHSDTWMVVLDPMKPGGPFEVMAQQTLEKINFTLRVHDVLFGDVWLCSGQSNMQMTVLQIFNATRELSNTAAYQSVRILSVSPIQAEQELEDLVAVDLQWSKPTSENLGHGYFKYMSAVCWLFGRHLYDTLQYPIGLIASSWGGTPIEAWSSGRSLKACGVPKQGSIPYDSVTGPSKHSVLWNAMIHPLCNMTLKGVVWYQGESNINYNTDLYNCTFPALIEDWRETFHRGSQGQTERFFPFGLVQLSSDLSKKSSDDGFPQIRWHQTADFGYVPNPKMPNTFMAVAMDLCDRDSPFGSIHPRDKQTVAYRLHLGARALAYGEKNLTFEGPLPEKIELLAHKGLLNLTYYQQIQVQKKDNKIFEISCCSDHRCKWLPASMNTVSTQSLTLAIDSCHGTVVALRYAWTTWPCEYKQCPLYHPSSALPAPPFIAFITDQGPGHQSNVAK

  • Predicted Molecular Mass

    57.4 kDa

  • Molecular Weight

    Approximately 61 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 8.0, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00