1. Recombinant Proteins
  2. CAR-T Related Proteins CD Antigens Receptor Proteins
  3. NK Cell CD Proteins Macrophage CD Proteins Monocyte CD Proteins Stem Cell CD Proteins Dendritic Cell CD Proteins Siglec
  4. Siglec-3/CD33
  5. Siglec-3/CD33 Protein, Mouse (HEK293)

Siglec-3/CD33, a sialic-acid-binding lectin, crucially mediates cell-cell interactions and immune cell quiescence. Preferring sialic acid on specific mucins, it forms homodimers, interacting with PTPN6/SHP-1 and PTPN11/SHP-2 upon phosphorylation. CD33 also engages C1QA through its C-terminus, activating CD33 inhibitory motifs. Siglec-3/CD33 Protein, Mouse (HEK293) is the recombinant mouse-derived Siglec-3/CD33 protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Siglec-3/CD33, a sialic-acid-binding lectin, crucially mediates cell-cell interactions and immune cell quiescence. Preferring sialic acid on specific mucins, it forms homodimers, interacting with PTPN6/SHP-1 and PTPN11/SHP-2 upon phosphorylation. CD33 also engages C1QA through its C-terminus, activating CD33 inhibitory motifs. Siglec-3/CD33 Protein, Mouse (HEK293) is the recombinant mouse-derived Siglec-3/CD33 protein, expressed by HEK293 , with tag free.

Background

Siglec-3/CD33, a sialic-acid-binding immunoglobulin-like lectin, plays a crucial role in mediating cell-cell interactions and maintaining immune cells in a resting state. It exhibits a preference for binding sialic acid on the short O-linked glycans of specific mucins. The protein forms homodimers through disulfide linkages and interacts with signaling molecules such as PTPN6/SHP-1 and PTPN11/SHP-2 upon phosphorylation. Additionally, CD33 engages with C1QA via its C-terminus, leading to the activation of CD33 inhibitory motifs.

Species

Mouse

Source

HEK293

Tag

Tag Free

Accession

Q63994-1 (Q17-E240)

Gene ID
Molecular Construction
N-term
CD33 (Q17-E240)
Accession # Q63994-1
C-term
Protein Length

Partial

Synonyms
Myeloid Cell Surface Antigen CD33; Siglec-3; gp67; CD33; SIGLEC3
AA Sequence

QDLEFQLVAPESVTVEEGLCVHVPCSVFYPSIKLTLGPVTGSWLRKGVSLHEDSPVATSDPRQLVQKATQGRFQLLGDPQKHDCSLFIRDAQKNDTGMYFFRVVREPFVRYSYKKSQLSLHVTSLSRTPDIIIPGTLEAGYPSNLTCSVPWACEQGTPPTFSWMSTALTSLSSRTTDSSVLTFTPQPQDHGTKLTCLVTFSGAGVTVERTIQLNVTRKSGQMRE

Predicted Molecular Mass
25.6 kDa
Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Siglec-3/CD33 Protein, Mouse (HEK293)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Siglec-3/CD33 Protein, Mouse (HEK293)
Cat. No.:
HY-P73641
Quantity:
MCE Japan Authorized Agent: