SKP1 Protein, Human (Biotinylated, HEK293, His-Avi)

Customer Review

Based on 1 Customer Validation

The SKP1 protein is a component of the SCF ubiquitin ligase complex and targets cell cycle progression and signal transduction. SKP1 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived SKP1 protein, expressed by HEK293 , with C-Avi, N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The SKP1 protein is a component of the SCF ubiquitin ligase complex and targets cell cycle progression and signal transduction. SKP1 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived SKP1 protein, expressed by HEK293 , with C-Avi, N-His labeled tag.

Background

SKP1, an indispensable component of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex, plays a crucial role in orchestrating the ubiquitination of proteins involved in diverse cellular processes, including cell cycle progression, signal transduction, and transcription. Within the SCF complex, SKP1 serves as an essential adapter, bridging the F-box protein to CUL1 and, consequently, facilitating the substrate recognition function of the SCF complex. The specificity of SCF-mediated ubiquitination is contingent on the F-box protein's unique substrate recognition capabilities. Several F-box proteins within the SCF complex, such as BTRC, FBXW11, SKP2, FBXW7, FBXO32, and others, are implicated in directing ubiquitination events targeting key regulatory proteins involved in Wnt signaling, NF-kappa-B activation, G1/S transition regulation, and diverse cellular pathways. This intricate network of interactions highlights SKP1's pivotal role as a molecular adapter in the SCF ubiquitin ligase complex, governing the dynamic regulation of protein modification through ubiquitination.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-Avi;N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • SKP1 (P2-K163)
      Accession # P63208
    • Avi
    • C-term
  • Protein Length

    Full Length

  • Conjugation

    Biotin

  • Conjugate Method

    The single lysine residue in Avitag is biotinylated through an enzymatic reaction.

  • Synonyms

    SKP1; Transcription Elongation Factor B Polypeptide 1-Like; Prev. SKP1A; Organ Of Corti Protein 2; TCEB1L; MGC34403; OCP-II; OCP-2; EMC19; SIII; OCP2; RNA Polymerase II Elongation Factor-Like Protein OCP2; P19A; RNA Polymerase II Elongation Factor-Like Pr

  • AA Sequence

    PSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK

  • Predicted Molecular Mass

    21.4 kDa

  • Molecular Weight

    Approximately 23-28 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00