SKP1 Protein, Human (Biotinylated, HEK293, His-Avi)
Based on 1 Customer Validation
The SKP1 protein is a component of the SCF ubiquitin ligase complex and targets cell cycle progression and signal transduction. SKP1 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived SKP1 protein, expressed by HEK293 , with C-Avi, N-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The SKP1 protein is a component of the SCF ubiquitin ligase complex and targets cell cycle progression and signal transduction. SKP1 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived SKP1 protein, expressed by HEK293 , with C-Avi, N-His labeled tag.
Background
SKP1, an indispensable component of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex, plays a crucial role in orchestrating the ubiquitination of proteins involved in diverse cellular processes, including cell cycle progression, signal transduction, and transcription. Within the SCF complex, SKP1 serves as an essential adapter, bridging the F-box protein to CUL1 and, consequently, facilitating the substrate recognition function of the SCF complex. The specificity of SCF-mediated ubiquitination is contingent on the F-box protein's unique substrate recognition capabilities. Several F-box proteins within the SCF complex, such as BTRC, FBXW11, SKP2, FBXW7, FBXO32, and others, are implicated in directing ubiquitination events targeting key regulatory proteins involved in Wnt signaling, NF-kappa-B activation, G1/S transition regulation, and diverse cellular pathways. This intricate network of interactions highlights SKP1's pivotal role as a molecular adapter in the SCF ubiquitin ligase complex, governing the dynamic regulation of protein modification through ubiquitination.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;N-His
-
Accession
P63208 (P2-K163)
-
Molecular Construction
-
N-term
-
His
-
SKP1 (P2-K163)
Accession # P63208 -
Avi
-
C-term
-
-
Protein Length
Full Length
-
Conjugation
Biotin
-
Conjugate Method
The single lysine residue in Avitag is biotinylated through an enzymatic reaction.
-
Synonyms
SKP1; Transcription Elongation Factor B Polypeptide 1-Like; Prev. SKP1A; Organ Of Corti Protein 2; TCEB1L; MGC34403; OCP-II; OCP-2; EMC19; SIII; OCP2; RNA Polymerase II Elongation Factor-Like Protein OCP2; P19A; RNA Polymerase II Elongation Factor-Like Pr
-
AA Sequence
PSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
-
Predicted Molecular Mass
21.4 kDa
-
Molecular Weight
Approximately 23-28 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)