SLC22A23 Protein, Human (HEK293, His, Strep, Flag)
SLC22A23 Protein, Human (HEK293, His, Strep, Flag) is the recombinant human-derived SLC22A23, expressed by HEK293 , with Strep, His, Flag labeled tag. ,
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
SLC22A23 Protein, Human (HEK293, His, Strep, Flag) is the recombinant human-derived SLC22A23, expressed by HEK293 , with Strep, His, Flag labeled tag. ,
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Strep;His;Flag
-
Accession
A1A5C7-1 (A2-M686)
-
Gene ID63027
-
Protein Length
Full Length of Isoform-1
-
Synonyms
SLC22A23; Chromosome 6 Open Reading Frame 85; Prev. C6orf85; CDNA: FLJ21380 Fis, Clone COL03329; FLJ22174; Ion Transporter Protein; Solute Carrier Family 22, Member 23; SLC22A23 Protein; Solute Carrier Family 22 Member 23; CDNA: FLJ22174 Fis, Clone HRC007
-
AA Sequence
AIDRRREAAGGGPGRQPAPAEENGSLPPGDAAASAPLGGRAGPGGGAEIQPLPPLHPGGGPHPSCCSAAAAPSLLLLDYDGSVLPFLGGLGGGYQKTLVLLTWIPALFIGFSQFSDSFLLDQPNFWCRGAGKGTELAGVTTTGRGGDMGNWTSLPTTPFATAPWEAAGNRSNSSGADGGDTPPLPSPPDKGDNASNCDCRAWDYGIRAGLVQNVVSKWDLVCDNAWKVHIAKFSLLVGLIFGYLITGCIADWVGRRPVLLFSIIFILIFGLTVALSVNVTMFSTLRFFEGFCLAGIILTLYALRIELCPPGKRFMITMVASFVAMAGQFLMPGLAALCRDWQVLQALIICPFLLMLLYWSIFPESLRWLMATQQFESAKRLILHFTQKNRMNPEGDIKGVIPELEKELSRRPKKVCIVKVVGTRNLWKNIVVLCVNSLTGYGIHHCFARSMMGHEVKVPLLENFYADYYTTASIALVSCLAMCVVVRFLGRRGGLLLFMILTALASLLQLGLLNLIGKYSQHPDSGMSDSVKDKFSIAFSIVGMFASHAVGSLSVFFCAEITPTVIRCGGLGLVLASAGFGMLTAPIIELHNQKGYFLHHIIFACCTLICIICILLLPESRDQNLPENISNGEHYTRQPLLPHKKGEQPLLLTNAELKDYSGLHDAAAAGDTLPEGATANGMKAM
-
Predicted Molecular Mass
77.8 kDa
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
