SLC30A8 Protein, Mouse (Cell-Free, His)
Based on 1 Customer Validation
SLC30A8 Protein, a proton-coupled zinc ion antiporter, crucially regulates insulin secretion. Serving as a mediator, SLC30A8 enables zinc entry into pancreatic beta cell secretory granules, maintaining the required zinc concentration. This process finely tunes insulin release dynamics, emphasizing SLC30A8's pivotal role in physiological insulin secretion control and glucose homeostasis. SLC30A8 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived SLC30A8 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.
- Species: Mouse
- Source: E. coli Cell-free
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
SLC30A8 Protein, a proton-coupled zinc ion antiporter, crucially regulates insulin secretion. Serving as a mediator, SLC30A8 enables zinc entry into pancreatic beta cell secretory granules, maintaining the required zinc concentration. This process finely tunes insulin release dynamics, emphasizing SLC30A8's pivotal role in physiological insulin secretion control and glucose homeostasis. SLC30A8 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived SLC30A8 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.
SLC30A8 Protein, identified as a proton-coupled zinc ion antiporter, plays a pivotal role in the intricate regulation of insulin secretion. Functioning as a mediator, SLC30A8 facilitates the entry of zinc into the lumen of pancreatic beta cell secretory granules. This process is crucial for maintaining the appropriate zinc concentration within the granules, ultimately influencing the dynamics of insulin release. By participating in the transport of zinc, SLC30A8 contributes to the finely tuned orchestration of cellular events within pancreatic beta cells, highlighting its significance in the physiological control of insulin secretion and, consequently, glucose homeostasis.
Technical Parameters
-
Species Mouse
-
Source E. coli Cell-free
-
Tag N-10*His
-
Accession
Q8BGG0 (M1-D367)
-
Gene ID239436
-
Molecular Construction
-
N-term
-
10*His
-
SLC30A8 (M1-D367)
Accession # Q8BGG0 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
SLC30A8; Solute Carrier Family 30 (Zinc Transporter), Member 8; Solute Carrier Family 30 Member 8; Proton-Coupled Zinc Antiporter SLC30A8; ZnT-8; Zinc Transporter 8; ZNT8; Zinc Transporter ZnT-8
-
AA Sequence
MEFLERTYLVNDQATKMYAFPLDRELRQKPVNKDQCPGDRPEHPEAGGIYHCHNSAKATGNRSSKQAHAKWRLCAASAICFIFMVAEVVGGHVAGSLAILTDAAHLLIDLTSFLLSLFSLWLSSRPPSKRLTFGWYRAEILGALLSVLCIWVVTGVLLYLACERLLYPDYQIQAGIMITVSGCAVAANIVLTMILHQRNFGYNHKDVQANASVRAAFVHALGDVFQSISVLISALIIYFKPDYKIADPVCTFIFSILVLASTVMILKDFSILLMEGVPKGLSYNSVKEIILAVDGVISVHSLHIWSLTVNQVILSVHVATAASQDSQSVRTGIAQALSSFDLHSLTIQIESAADQDPSCLLCEDPQD
-
Predicted Molecular Mass
43 kDa
-
Molecular Weight
Approximately 43 kDa (Monomer) & 86 kDa (Dimer), based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.15M NaCl, 0.05%BRIJ-78, 6% Trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add 5-50% of glycerol (final concentration). Our default final concentration of glycerol is 50%. Customers could use it as reference.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
