SLC35A2 Protein, Human (sf9, His, MBP, FLAG)

Cat. No.: HY-P702034: Ficha de datos Instrucciones de manejo
FAQs
Technical Support

SLC35A2 is a key transmembrane protein that acts as an antiporter to transport uridine diphosphate galactose (UDP-galactose) into the Golgi apparatus. The process involves the exchange of UDP-galactose with UMP and exhibits versatility through exchange with AMP and CMP. SLC35A2 Protein, Human (sf9, His, MBP, FLAG) is the recombinant human-derived SLC35A2 protein, expressed by sf9 insect cells , with N-MBP, C-Flag, N-8*His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service Protein Expression Service

Tamaño		Stock
MOQ		Minimum order quantity
50 μg		Obtener un presupuesto
100 μg		Obtener un presupuesto
Other size		Obtener un presupuesto

* Seleccione Cantidad antes de agregar artículos.

1 Publications Citing Use of MCE SLC35A2 Protein, Human (sf9, His, MBP, FLAG)

•Biochem Pharmacol. 2025 Sep 13;242(Pt 2):117339. [Abstract]

Actividad biológica
Technical Parameters
Properties
Descripciòn

Descripciòn	SLC35A2 is a key transmembrane protein that acts as an antiporter to transport uridine diphosphate galactose (UDP-galactose) into the Golgi apparatus. The process involves the exchange of UDP-galactose with UMP and exhibits versatility through exchange with AMP and CMP. SLC35A2 Protein, Human (sf9, His, MBP, FLAG) is the recombinant human-derived SLC35A2 protein, expressed by sf9 insect cells , with N-MBP, C-Flag, N-8*His labeled tag.
Background	SLC35A2, a pivotal transmembrane protein, operates as an antiporter facilitating the transportation of uridine diphosphate galactose (UDP-galactose) from the cytosol into the Golgi apparatus. This dynamic process involves the exchange of UDP-galactose for UMP and demonstrates versatility by also accommodating the exchange of UDP-galactose for AMP and CMP. Furthermore, SLC35A2 exhibits the ability to transport other nucleotide sugars, including UDP-N-acetylgalactosamine (UDP-GalNAc). Its role as a provider of UDP-galactose to galactosyltransferases within the Golgi apparatus is particularly crucial for the synthesis of globotriaosylceramide/globoside (Gb3Cer) from lactosylceramide, underscoring its significance in glycosphingolipid biosynthesis.
Species	Human
Source	Sf9 insect cells
Tag	N-MBP;C-Flag;N-8*His
Accession	P78381 (A2-S396)
Gene ID	7355
Molecular Construction	N-term 8*His-MBP SLC35A2 (A2-S396) Accession # P78381 Flag C-term
Protein Length	Partial
Synonyms	SLC35A2; UDP-galactose translocator; Solute carrier family 35 member A2; UDP-galactose transporter; UDP-Gal-Tr; UGT
AA Sequence	AAVGAGGSTAAPGPGAVSAGALEPGTASAAHRRLKYISLAVLVVQNASLILSIRYARTLPGDRFFATTAVVMAEVLKGLTCLLLLFAQKRGNVKHLVLFLHEAVLVQYVDTLKLAVPSLIYTLQNNLQYVAISNLPAATFQVTYQLKILTTALFSVLMLNRSLSRLQWASLLLLFTGVAIVQAQQAGGGGPRPLDQNPGAGLAAVVASCLSSGFAGVYFEKILKGSSGSVWLRNLQLGLFGTALGLVGLWWAEGTAVATRGFFFGYTPAVWGVVLNQAFGGLLVAVVVKYADNILKGFATSLSIVLSTVASIRLFGFHVDPLFALGAGLVIGAVYLYSLPRGAAKAIASASASASGPCVHQQPPGQPPPPQLSSHRGDLITEPFLPKLLTKVKGS
Pureza	≥ 90%, as determined by reducing SDS-PAGE.
Endotoxin Level	<1 EU/μg, determined by LAL method.
Documentación	Ficha de datos (237 KB) Instrucciones de manejo (2659 KB)