1. Recombinant Proteins
  2. Others
  3. SLC35A2 Protein, Human (sf9, His, MBP, FLAG)

SLC35A2 Protein, Human (sf9, His, MBP, FLAG)

Cat. No.: HY-P702034
Handling Instructions Technical Support

SLC35A2 is a key transmembrane protein that acts as an antiporter to transport uridine diphosphate galactose (UDP-galactose) into the Golgi apparatus. The process involves the exchange of UDP-galactose with UMP and exhibits versatility through exchange with AMP and CMP. SLC35A2 Protein, Human (sf9, His, MBP, FLAG) is the recombinant human-derived SLC35A2 protein, expressed by sf9 insect cells , with N-MBP, C-Flag, N-8*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE SLC35A2 Protein, Human (sf9, His, MBP, FLAG)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SLC35A2 is a key transmembrane protein that acts as an antiporter to transport uridine diphosphate galactose (UDP-galactose) into the Golgi apparatus. The process involves the exchange of UDP-galactose with UMP and exhibits versatility through exchange with AMP and CMP. SLC35A2 Protein, Human (sf9, His, MBP, FLAG) is the recombinant human-derived SLC35A2 protein, expressed by sf9 insect cells , with N-MBP, C-Flag, N-8*His labeled tag.

Background

SLC35A2, a pivotal transmembrane protein, operates as an antiporter facilitating the transportation of uridine diphosphate galactose (UDP-galactose) from the cytosol into the Golgi apparatus. This dynamic process involves the exchange of UDP-galactose for UMP and demonstrates versatility by also accommodating the exchange of UDP-galactose for AMP and CMP. Furthermore, SLC35A2 exhibits the ability to transport other nucleotide sugars, including UDP-N-acetylgalactosamine (UDP-GalNAc). Its role as a provider of UDP-galactose to galactosyltransferases within the Golgi apparatus is particularly crucial for the synthesis of globotriaosylceramide/globoside (Gb3Cer) from lactosylceramide, underscoring its significance in glycosphingolipid biosynthesis.

Species

Human

Source

Sf9 insect cells

Tag

N-MBP;C-Flag;N-8*His

Accession

P78381 (A2-S396)

Gene ID

7355

Molecular Construction
N-term
8*His-MBP
SLC35A2 (A2-S396)
Accession # P78381
Flag
C-term
Protein Length

Partial

Synonyms
SLC35A2; UDP-galactose translocator; Solute carrier family 35 member A2; UDP-galactose transporter; UDP-Gal-Tr; UGT
AA Sequence

AAVGAGGSTAAPGPGAVSAGALEPGTASAAHRRLKYISLAVLVVQNASLILSIRYARTLPGDRFFATTAVVMAEVLKGLTCLLLLFAQKRGNVKHLVLFLHEAVLVQYVDTLKLAVPSLIYTLQNNLQYVAISNLPAATFQVTYQLKILTTALFSVLMLNRSLSRLQWASLLLLFTGVAIVQAQQAGGGGPRPLDQNPGAGLAAVVASCLSSGFAGVYFEKILKGSSGSVWLRNLQLGLFGTALGLVGLWWAEGTAVATRGFFFGYTPAVWGVVLNQAFGGLLVAVVVKYADNILKGFATSLSIVLSTVASIRLFGFHVDPLFALGAGLVIGAVYLYSLPRGAAKAIASASASASGPCVHQQPPGQPPPPQLSSHRGDLITEPFLPKLLTKVKGS

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

SLC35A2 Protein, Human (sf9, His, MBP, FLAG) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

SLC35A2 Protein, Human (sf9, His, MBP, FLAG)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SLC35A2 Protein, Human (sf9, His, MBP, FLAG)
Cat. No.:
HY-P702034
Quantity:
MCE Japan Authorized Agent: