Copy Link Print Information

SLC35A2 Protein, Human (sf9, His, MBP, FLAG)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

SLC35A2 is a key transmembrane protein that acts as an antiporter to transport uridine diphosphate galactose (UDP-galactose) into the Golgi apparatus. The process involves the exchange of UDP-galactose with UMP and exhibits versatility through exchange with AMP and CMP. SLC35A2 Protein, Human (sf9, His, MBP, FLAG) is the recombinant human-derived SLC35A2 protein, expressed by sf9 insect cells , with N-MBP, C-Flag, N-8*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • SLC35A2 Protein, Human (sf9, His, MBP, FLAG) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

SLC35A2 is a key transmembrane protein that acts as an antiporter to transport uridine diphosphate galactose (UDP-galactose) into the Golgi apparatus. The process involves the exchange of UDP-galactose with UMP and exhibits versatility through exchange with AMP and CMP. SLC35A2 Protein, Human (sf9, His, MBP, FLAG) is the recombinant human-derived SLC35A2 protein, expressed by sf9 insect cells , with N-MBP, C-Flag, N-8*His labeled tag.

Background

SLC35A2, a pivotal transmembrane protein, operates as an antiporter facilitating the transportation of uridine diphosphate galactose (UDP-galactose) from the cytosol into the Golgi apparatus. This dynamic process involves the exchange of UDP-galactose for UMP and demonstrates versatility by also accommodating the exchange of UDP-galactose for AMP and CMP. Furthermore, SLC35A2 exhibits the ability to transport other nucleotide sugars, including UDP-N-acetylgalactosamine (UDP-GalNAc). Its role as a provider of UDP-galactose to galactosyltransferases within the Golgi apparatus is particularly crucial for the synthesis of globotriaosylceramide/globoside (Gb3Cer) from lactosylceramide, underscoring its significance in glycosphingolipid biosynthesis.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-MBP;C-Flag;N-8*His
  • Accession

    P78381 (A2-S396)

  • Gene ID
    7355
  • Molecular Construction
    • N-term
    • 8*His-MBP
    • SLC35A2 (A2-S396)
      Accession # P78381
    • Flag
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    SLC35A2; UGT2; Prev. UGALT; Solute Carrier Family 35 (UDP-Galactose Transporter), Member 2; UDP-Gal-Tr; CDNA FLJ59970, Highly Similar To UDP-Galactose Translocator; UGTL; CDNA FLJ53300, Highly Similar To UDP-Galactose Translocator; UGT; UDP-Galactose Tran

  • AA Sequence

    AAVGAGGSTAAPGPGAVSAGALEPGTASAAHRRLKYISLAVLVVQNASLILSIRYARTLPGDRFFATTAVVMAEVLKGLTCLLLLFAQKRGNVKHLVLFLHEAVLVQYVDTLKLAVPSLIYTLQNNLQYVAISNLPAATFQVTYQLKILTTALFSVLMLNRSLSRLQWASLLLLFTGVAIVQAQQAGGGGPRPLDQNPGAGLAAVVASCLSSGFAGVYFEKILKGSSGSVWLRNLQLGLFGTALGLVGLWWAEGTAVATRGFFFGYTPAVWGVVLNQAFGGLLVAVVVKYADNILKGFATSLSIVLSTVASIRLFGFHVDPLFALGAGLVIGAVYLYSLPRGAAKAIASASASASGPCVHQQPPGQPPPPQLSSHRGDLITEPFLPKLLTKVKGS

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • SLC35A2 Protein, Human (sf9, His, MBP, FLAG) Product Image
    1/16
  • SLC35A2 Protein, Human (sf9, His, MBP, FLAG) Product Image