SLIT2 Protein, Human (208a.a, HEK293, His)
Slit2 is a key protein in cell migration and guides axonal navigation in neural development by interacting with detour cognate receptors. In the forebrain, Slit2 acts as a repulsive signal, preventing axons from incorrectly crossing the midline. SLIT2 Protein, Human (208a.a, HEK293, His) is the recombinant human-derived SLIT2 protein, expressed by HEK293, with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Slit2 is a key protein in cell migration and guides axonal navigation in neural development by interacting with detour cognate receptors. In the forebrain, Slit2 acts as a repulsive signal, preventing axons from incorrectly crossing the midline. SLIT2 Protein, Human (208a.a, HEK293, His) is the recombinant human-derived SLIT2 protein, expressed by HEK293, with C-His labeled tag.
Background
Slit2, a pivotal protein in cellular migration, acts as a molecular guidance cue with its function mediated by interactions with roundabout homolog receptors. In neural development, Slit2 contributes to axonal navigation at the ventral midline of the neural tube, guiding the projection of axons to distinct regions. Particularly essential in forebrain midline guidance, SLIT1 and SLIT2 act as repulsive signals, preventing improper midline crossing by axons originating from the olfactory bulb. In spinal cord development, Slit2 likely plays a role in guiding commissural axons upon reaching the floor plate, modulating responses to netrin. Silencing the attractive effect of NTN1 in vitro requires the formation of a ROBO1-DCC complex. Furthermore, Slit2 is implicated in spinal cord midline post-crossing axon repulsion. In the developing visual system, it serves as a repellent for retinal ganglion axons, directing them along appropriate paths before and after the optic chiasm. Slit2 is also involved in branching and arborization of CNS sensory axons and neuronal cell migration. Notably, Slit2 regulates leukocyte migration, adding to its diverse functions. Interacting with GREM1, Slit2 forms homodimers and binds to ROBO1 and ROBO2 with high affinity.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
O94813-1 (L271-S479)
-
Gene ID9353
-
Molecular Construction
-
N-term
-
SLIT2 (L271-S479)
Accession # O94813-1 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
SLIT2; Slit Homolog 2 Protein; Prev. SLIL3; Slit (Drosophila) Homolog 2; Slit-2; Slit Homolog 2 (Drosophila); Slit Guidance Ligand 2; Uncharacterized Protein SLIT2
-
AA Sequence
LHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRCS
-
Predicted Molecular Mass
25.3 kDa
-
Molecular Weight
Approximately 26 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Structure/Form
Monomer
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)