1. Recombinant Proteins
  2. Others
  3. SLIT2 Protein, Human (208a.a, HEK293, His)

Slit2 is a key protein in cell migration and guides axonal navigation in neural development by interacting with detour cognate receptors. In the forebrain, Slit2 acts as a repulsive signal, preventing axons from incorrectly crossing the midline. SLIT2 Protein, Human (208a.a, HEK293, His) is the recombinant human-derived SLIT2 protein, expressed by HEK293, with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
100 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Slit2 is a key protein in cell migration and guides axonal navigation in neural development by interacting with detour cognate receptors. In the forebrain, Slit2 acts as a repulsive signal, preventing axons from incorrectly crossing the midline. SLIT2 Protein, Human (208a.a, HEK293, His) is the recombinant human-derived SLIT2 protein, expressed by HEK293, with C-His labeled tag.

Background

Slit2, a pivotal protein in cellular migration, acts as a molecular guidance cue with its function mediated by interactions with roundabout homolog receptors. In neural development, Slit2 contributes to axonal navigation at the ventral midline of the neural tube, guiding the projection of axons to distinct regions. Particularly essential in forebrain midline guidance, SLIT1 and SLIT2 act as repulsive signals, preventing improper midline crossing by axons originating from the olfactory bulb. In spinal cord development, Slit2 likely plays a role in guiding commissural axons upon reaching the floor plate, modulating responses to netrin. Silencing the attractive effect of NTN1 in vitro requires the formation of a ROBO1-DCC complex. Furthermore, Slit2 is implicated in spinal cord midline post-crossing axon repulsion. In the developing visual system, it serves as a repellent for retinal ganglion axons, directing them along appropriate paths before and after the optic chiasm. Slit2 is also involved in branching and arborization of CNS sensory axons and neuronal cell migration. Notably, Slit2 regulates leukocyte migration, adding to its diverse functions. Interacting with GREM1, Slit2 forms homodimers and binds to ROBO1 and ROBO2 with high affinity.

Species

Human

Source

HEK293

Tag

C-His

Accession

O94813-1 (L271-S479)

Gene ID

9353

Molecular Construction
N-term
SLIT2 (L271-S479)
Accession # O94813-1
His
C-term
Protein Length

Partial

Synonyms
SLIT2 ; Slit homolog 2 protein ; SLIL3 ; Slit-2
AA Sequence

LHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRCS

Predicted Molecular Mass
25.3 kDa
Molecular Weight

Approximately 26 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Structure/Form
Monomer
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from 0.22 μm filtered solution of 100 mM HEPES, 500 mM NaCl, pH7.0 with 10% trehalose as protectant.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SLIT2 Protein, Human (208a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

SLIT2 Protein, Human (208a.a, HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SLIT2 Protein, Human (208a.a, HEK293, His)
Cat. No.:
HY-P704222
Quantity:
MCE Japan Authorized Agent: