SMAC/Diablo Protein, Human (His)

SMAC/Diablo protein is a core participant in apoptosis and activates caspases in the cytochrome c/Apaf-1/caspase-9 pathway. It antagonizes inhibitors of apoptosis proteins (IAPs), inhibits the binding of BIRC6/bruce to caspases and destabilizes XIAP/BIRC4. SMAC/Diablo Protein, Human (His) is the recombinant human-derived SMAC/Diablo protein, expressed by E. coli , with C-His labeled tag.

SMAC/Diablo protein plays a pivotal role in apoptosis by instigating the activation of caspases within the cytochrome c/Apaf-1/caspase-9 pathway. Its mode of action involves counteracting the inhibitory effects of inhibitor of apoptosis proteins (IAP). SMAC/Diablo effectively hinders the activity of BIRC6/bruce by impeding its binding to caspases. Furthermore, it exerts its regulatory influence on XIAP/BIRC4 by diminishing its stability and apoptosis-inhibiting capabilities. This is achieved through the facilitation of XIAP/BIRC4 ubiquitination and subsequent degradation via the ubiquitin-proteasome pathway. Notably, SMAC/Diablo disrupts the interaction between XIAP/BIRC4 and processed caspase-9, thereby promoting the activation of caspase-3. In essence, SMAC/Diablo emerges as a key orchestrator in the intricate molecular machinery governing apoptotic processes.

Measured by its binding ability in a functional ELISA. Immobilized Human SMAC at 10 μg/mL (100 μL/well) can bind Biotinylated XIAP. The ED₅₀ for this effect is 0.328 μg/mL.

Human

E. coli

C-His

Q9NR28-1 (A56-D239)

56616  [NCBI]

Partial

AVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED

Approximately 22 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.