Copy Link Print Information

SMAC/Diablo Protein, Human (His)

Customer Review

Based on 1 Customer Validation

SMAC/Diablo protein is a core participant in apoptosis and activates caspases in the cytochrome c/Apaf-1/caspase-9 pathway. It antagonizes inhibitors of apoptosis proteins (IAPs), inhibits the binding of BIRC6/bruce to caspases and destabilizes XIAP/BIRC4. SMAC/Diablo Protein, Human (His) is the recombinant human-derived SMAC/Diablo protein, expressed by E. coli , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • SMAC/Diablo Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

SMAC/Diablo protein is a core participant in apoptosis and activates caspases in the cytochrome c/Apaf-1/caspase-9 pathway. It antagonizes inhibitors of apoptosis proteins (IAPs), inhibits the binding of BIRC6/bruce to caspases and destabilizes XIAP/BIRC4. SMAC/Diablo Protein, Human (His) is the recombinant human-derived SMAC/Diablo protein, expressed by E. coli , with C-His labeled tag.

Background

SMAC/Diablo protein plays a pivotal role in apoptosis by instigating the activation of caspases within the cytochrome c/Apaf-1/caspase-9 pathway. Its mode of action involves counteracting the inhibitory effects of inhibitor of apoptosis proteins (IAP). SMAC/Diablo effectively hinders the activity of BIRC6/bruce by impeding its binding to caspases. Furthermore, it exerts its regulatory influence on XIAP/BIRC4 by diminishing its stability and apoptosis-inhibiting capabilities. This is achieved through the facilitation of XIAP/BIRC4 ubiquitination and subsequent degradation via the ubiquitin-proteasome pathway. Notably, SMAC/Diablo disrupts the interaction between XIAP/BIRC4 and processed caspase-9, thereby promoting the activation of caspase-3. In essence, SMAC/Diablo emerges as a key orchestrator in the intricate molecular machinery governing apoptotic processes.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human SMAC at 10 μg/mL (100 μL/well) can bind Biotinylated XIAP. The ED50 for this effect is 0.328 μg/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-His
  • Accession

    Q9NR28-1 (A56-D239)

  • Gene ID
    56616  [NCBI]
  • Molecular Construction
    • N-term
    • SMAC (A56-D239)
      Accession # Q9NR28-1
    • His
    • C-term
  • Protein Length

    Full Length of Diablo IAP-binding mitochondrial protein, cleaved form Chain

  • Synonyms

    DIABLO; Second Mitochondria-Derived Activator Of Caspase; Diablo IAP-Binding Mitochondrial Protein; DIABLO-S; SMAC; FLJ25049; Direct IAP-Binding Protein With Low PI; FLJ10537; Diablo Homolog, Mitochondrial; Diablo, IAP-Binding Mitochondrial Protein; DFNA6

  • AA Sequence

    AVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED

  • Molecular Weight

    Approximately 22-22 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • SMAC/Diablo Protein, Human (His) Product Image
    1/16
  • SMAC/Diablo Protein, Human (His) Product Image