SMN1 Protein, Human (His)
SMN1 Protein, Human (His) is the recombinant human-derived SMN1 protein, expressed by E. coli, with N-His tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
SMN1 Protein, Human (His) is the recombinant human-derived SMN1 protein, expressed by E. coli, with N-His tag.
Background
The SMN complex catalyzes the assembly of small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome, playing a crucial role in the splicing of cellular pre-mRNAs. Most spliceosomal snRNPs contain a common set of Sm proteins (SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF, and SNRPG) that assemble into a heptameric protein ring on the Sm site of small nuclear RNA to form the core snRNP (Sm core). In the cytosol, the Sm proteins SNRPD1, SNRPD2, SNRPE, SNRPF, and SNRPG are trapped in an inactive 6S pICln-Sm complex by the chaperone CLNS1A, which regulates core snRNP assembly. The SMN complex accepts the trapped 5Sm proteins from CLNS1A to form an intermediate, with SMN1 acting as a structural backbone alongside GEMIN2 to gather Sm complex subunits. Binding of snRNA within 5Sm triggers the eviction of the SMN complex, allowing SNRPD3 and SNRPB to complete core snRNP assembly. The SMN complex also ensures proper splicing of U12 intron-containing genes, which may be important for normal motor and proprioceptive neuron development. Additionally, it resolves RNA-DNA hybrids formed by RNA polymerase II, which create R-loops in transcription termination regions, a critical step in proper transcription termination. It may also play a role in small nucleolar ribonucleoprotein (snoRNPs) metabolism.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
Q16637-1 (A2-N294)
-
Gene ID6606
-
Molecular Construction
-
N-term
-
His
-
Q16637-1 SMN1 (A2-N294)
Accession # -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
SMN1; Survival Of Motor Neuron 2 Isoform D2A2B345; Prev. SMA@; Survival Of Motor Neuron 2 Isoform D2B3457; Prev. SMA; Survival Of Motor Neuron 1 Isoform D2B3457; SMNT; Survival Of Motor Neuron 2 Isoform D2A3457; Survival Motor Neuron Protein; Survival Of
-
AA Sequence
AMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMGFRQNQKEGRCSHSLN
-
Predicted Molecular Mass
33.7 kDa
-
Molecular Weight
Approximately 36-40 kDa & 69 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
/
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)