SMN1 Protein, Human (His)

SMN1 Protein, Human (His) is the recombinant human-derived SMN1 protein, expressed by E. coli, with N-His tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

SMN1 Protein, Human (His) is the recombinant human-derived SMN1 protein, expressed by E. coli, with N-His tag.

Background

The SMN complex catalyzes the assembly of small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome, playing a crucial role in the splicing of cellular pre-mRNAs. Most spliceosomal snRNPs contain a common set of Sm proteins (SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF, and SNRPG) that assemble into a heptameric protein ring on the Sm site of small nuclear RNA to form the core snRNP (Sm core). In the cytosol, the Sm proteins SNRPD1, SNRPD2, SNRPE, SNRPF, and SNRPG are trapped in an inactive 6S pICln-Sm complex by the chaperone CLNS1A, which regulates core snRNP assembly. The SMN complex accepts the trapped 5Sm proteins from CLNS1A to form an intermediate, with SMN1 acting as a structural backbone alongside GEMIN2 to gather Sm complex subunits. Binding of snRNA within 5Sm triggers the eviction of the SMN complex, allowing SNRPD3 and SNRPB to complete core snRNP assembly. The SMN complex also ensures proper splicing of U12 intron-containing genes, which may be important for normal motor and proprioceptive neuron development. Additionally, it resolves RNA-DNA hybrids formed by RNA polymerase II, which create R-loops in transcription termination regions, a critical step in proper transcription termination. It may also play a role in small nucleolar ribonucleoprotein (snoRNPs) metabolism.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • Q16637-1 SMN1 (A2-N294)
      Accession #
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    SMN1; Survival Of Motor Neuron 2 Isoform D2A2B345; Prev. SMA@; Survival Of Motor Neuron 2 Isoform D2B3457; Prev. SMA; Survival Of Motor Neuron 1 Isoform D2B3457; SMNT; Survival Of Motor Neuron 2 Isoform D2A3457; Survival Motor Neuron Protein; Survival Of

  • AA Sequence

    AMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMGFRQNQKEGRCSHSLN

  • Predicted Molecular Mass

    33.7 kDa

  • Molecular Weight

    Approximately 36-40 kDa & 69 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

/

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00