SMYD2 Protein, Human (sf9, His)
Based on 1 publication(s) in Google Scholar
The SMYD2 protein is a multifunctional methyltransferase that can modify histones and non-histone proteins, including p53/TP53 and RB1. Notably, it trimethylates H3 at "Lys-4" (H3K4me3), which is critical for gene activation. SMYD2 Protein, Human (sf9, His) is the recombinant human-derived SMYD2 protein, expressed by Sf9 insect cells , with N-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The SMYD2 protein is a multifunctional methyltransferase that can modify histones and non-histone proteins, including p53/TP53 and RB1. Notably, it trimethylates H3 at "Lys-4" (H3K4me3), which is critical for gene activation. SMYD2 Protein, Human (sf9, His) is the recombinant human-derived SMYD2 protein, expressed by Sf9 insect cells , with N-His labeled tag.
SMYD2 protein, a versatile protein-lysine N-methyltransferase, exhibits the capability to methylate both histones and non-histone proteins, such as p53/TP53 and RB1. Notably, it specifically trimethylates histone H3 at 'Lys-4' (H3K4me3) in vivo, a crucial modification associated with gene activation. The enzymatic activity of SMYD2 requires interaction with HSP90alpha, further highlighting its functional dependence on cellular regulatory networks. Strikingly, SMYD2 demonstrates heightened methyltransferase activity on p53/TP53, where it monomethylates 'Lys-370,' leading to a consequential reduction in DNA-binding activity and subsequent transcriptional regulation. Furthermore, SMYD2 plays a role in the epigenetic modification of RB1 by monomethylating 'Lys-860,' showcasing its broad impact on both histone and non-histone proteins, thereby contributing to the intricate landscape of epigenetic regulation within the cellular milieu.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Biochem Pharmacol
Lysine methylation-mediated SMYD2 degradation by casticin sensitizes non-small-cell lung cancer cells to osimertinib therapy. [Abstract]2026 Jan;243(Pt 2):117562. PMID: 41314435
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-10*His
-
Accession
Q9NRG4-1 (M1-H433)
-
Molecular Construction
-
N-term
-
His
-
SMYD2 (M1-H433)
Accession # Q9NRG4-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
SMYD2; Histone Methyltransferase SMYD2; SET And MYND Domain Containing 2; ZMYND14; HSKM-B; Lysine N-Methyltransferase 3C; KMT3C; [Histone H3]-Lysine(4) N-Trimethyltransferase; SET And MYND Domain-Containing Protein 2; Zinc Finger, MYND Domain Containing 1
-
AA Sequence
MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
-
Molecular Weight
Approximately 48 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 10% glycerol, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
