SNCA Protein, Cynomolgus (His)
- Species: Cynomolgus
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Technical Parameters
-
Species Cynomolgus
-
Source E. coli
-
Tag C-His
-
Accession
P61142 (M1-A140)
-
Gene ID102119369
-
Molecular Construction
-
N-term
-
SNCA (M1-A140)
Accession # P61142 -
His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
SNCA; Parkinson Disease (Autosomal Dominant, Lewy Body) 4; Prev. PARK1; Non-A4 Component Of Amyloid Precursor; Prev. PARK4; Non A-Beta Component Of AD Amyloid; Alpha-Synuclein; Non-A Beta Component Of AD Amyloid; NACP; Synuclein Alpha-140; PD1; I+/--Synuc
-
AA Sequence
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFIKKDQLGKNEEGAPQEGILQDMPVDPDNEAYEMPSEEGYQDYEPEA
-
Predicted Molecular Mass
16.4 kDa
-
Molecular Weight
Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
