SNCA Protein, Human (Biotinylated, HEK293, His-Avi)
Alpha-synuclein (SNCA) is a key neuronal protein that regulates synaptic activity, including vesicle transport and neurotransmitter release. As a monomer, it enhances vesicle exocytosis, promotes fusion and fusion pore expansion, and increases local Ca(2+) release. SNCA Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived SNCA protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Alpha-synuclein (SNCA) is a key neuronal protein that regulates synaptic activity, including vesicle transport and neurotransmitter release. As a monomer, it enhances vesicle exocytosis, promotes fusion and fusion pore expansion, and increases local Ca(2+) release. SNCA Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived SNCA protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
Background
alpha-Synuclein (SNCA), a pivotal neuronal protein, orchestrates diverse roles in synaptic activity, including the regulation of synaptic vesicle trafficking and neurotransmitter release. As a monomer, it actively participates in synaptic vesicle exocytosis, enhancing vesicle priming, fusion, and dilation of exocytotic fusion pores, and mechanistically increases local Ca(2+) release from microdomains, crucial for ATP-induced exocytosis. In its multimeric membrane-bound state, SNCA functions as a molecular chaperone, assisting in the folding of synaptic fusion components (SNAREs) at the presynaptic plasma membrane, a process vital for maintaining normal SNARE-complex assembly during aging. SNCA also plays a crucial role in regulating dopamine neurotransmission by interacting with the dopamine transporter (DAT1) and modulating its activity. Existing as both a soluble monomer and homotetramer, a dynamic intracellular population of tetramers and monomers coexists, with the tetramer playing an essential role in maintaining homeostasis. SNCA engages in a complex network of interactions with proteins such as UCHL1, synphilin-1/SNCAIP, CALM1, STXBP1, VAMP2, SNAP25, RPH3A, RAB3A, SERF1A, and SEPTIN4, highlighting its involvement in intricate molecular processes governing synaptic function and integrity.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-His
-
Accession
P37840-1 (M1-A140)
-
Protein Length
Full Length of Isoform-1
-
Conjugation
Biotin
-
Synonyms
SNCA; Parkinson Disease (Autosomal Dominant, Lewy Body) 4; Prev. PARK1; Non-A4 Component Of Amyloid Precursor; Prev. PARK4; Non A-Beta Component Of AD Amyloid; Alpha-Synuclein; Non-A Beta Component Of AD Amyloid; NACP; Synuclein Alpha-140; PD1; I+/--Synuc
-
AA Sequence
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
-
Predicted Molecular Mass
18 kDa
-
Molecular Weight
Approximately 23 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)