SNCA Protein, Human (Biotinylated, HEK293, His-Avi)

Alpha-synuclein (SNCA) is a key neuronal protein that regulates synaptic activity, including vesicle transport and neurotransmitter release. As a monomer, it enhances vesicle exocytosis, promotes fusion and fusion pore expansion, and increases local Ca(2+) release. SNCA Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived SNCA protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Alpha-synuclein (SNCA) is a key neuronal protein that regulates synaptic activity, including vesicle transport and neurotransmitter release. As a monomer, it enhances vesicle exocytosis, promotes fusion and fusion pore expansion, and increases local Ca(2+) release. SNCA Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived SNCA protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

alpha-Synuclein (SNCA), a pivotal neuronal protein, orchestrates diverse roles in synaptic activity, including the regulation of synaptic vesicle trafficking and neurotransmitter release. As a monomer, it actively participates in synaptic vesicle exocytosis, enhancing vesicle priming, fusion, and dilation of exocytotic fusion pores, and mechanistically increases local Ca(2+) release from microdomains, crucial for ATP-induced exocytosis. In its multimeric membrane-bound state, SNCA functions as a molecular chaperone, assisting in the folding of synaptic fusion components (SNAREs) at the presynaptic plasma membrane, a process vital for maintaining normal SNARE-complex assembly during aging. SNCA also plays a crucial role in regulating dopamine neurotransmission by interacting with the dopamine transporter (DAT1) and modulating its activity. Existing as both a soluble monomer and homotetramer, a dynamic intracellular population of tetramers and monomers coexists, with the tetramer playing an essential role in maintaining homeostasis. SNCA engages in a complex network of interactions with proteins such as UCHL1, synphilin-1/SNCAIP, CALM1, STXBP1, VAMP2, SNAP25, RPH3A, RAB3A, SERF1A, and SEPTIN4, highlighting its involvement in intricate molecular processes governing synaptic function and integrity.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-Avi;C-His
  • Accession
  • Gene ID
  • Protein Length

    Full Length of Isoform-1

  • Conjugation

    Biotin

  • Synonyms

    SNCA; Parkinson Disease (Autosomal Dominant, Lewy Body) 4; Prev. PARK1; Non-A4 Component Of Amyloid Precursor; Prev. PARK4; Non A-Beta Component Of AD Amyloid; Alpha-Synuclein; Non-A Beta Component Of AD Amyloid; NACP; Synuclein Alpha-140; PD1; I+/--Synuc

  • AA Sequence

    MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

  • Predicted Molecular Mass

    18 kDa

  • Molecular Weight

    Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00