SNCG Protein, Human
Based on 1 Customer Validation
SNCG proteins help maintain the integrity of neurofilament networks and may influence axonal structure during development and adulthood. In vitro, it enhances the sensitivity of neurofilament-H to calcium-dependent proteases. SNCG Protein, Human is the recombinant human-derived SNCG protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
SNCG proteins help maintain the integrity of neurofilament networks and may influence axonal structure during development and adulthood. In vitro, it enhances the sensitivity of neurofilament-H to calcium-dependent proteases. SNCG Protein, Human is the recombinant human-derived SNCG protein, expressed by E. coli , with tag free.
Background
SNCG protein plays a crucial role in maintaining neurofilament network integrity, suggesting involvement in shaping axonal architecture during both developmental stages and adulthood. Additionally, it may contribute to modulating the keratin network in the skin. In vitro studies indicate that SNCG increases the susceptibility of neurofilament-H to calcium-dependent proteases, implying a role in regulating neurofilament dynamics. Furthermore, SNCG activates the MAPK and Elk-1 signal transduction pathway and exhibits potential centrosome association. Its interaction with MYOC influences MYOC secretion and aggregation, highlighting SNCG's diverse involvement in cellular processes with implications for neuronal and skin-related functions.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. When Recombinant Human SNCG is immobilized at 2.5 µg/mL(100 µL/well) can bind Anti-SNCG. The ED50 for this effect is 147.1 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
O76070 (M1-D127)
-
Molecular Construction
-
N-term
-
SNCG (M1-D127)
Accession # O76070 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
SNCG; Synuclein, Gamma (Breast Cancer-Specific Protein 1); Synuclein Gamma; Breast Cancer-Specific Gene 1; Persyn; E Pound-Synuclein; BCSG1; Ɣ-Synuclein; SR; -Synuclein; Gamma-Synuclein; PERSYN; Synoretin; PRSN; Breast Cancer-Specific Gene 1 Protein
-
AA Sequence
MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD
-
Predicted Molecular Mass
13.6 kDa
-
Molecular Weight
Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)