SNCG Protein, Human

Customer Review

Based on 1 Customer Validation

SNCG proteins help maintain the integrity of neurofilament networks and may influence axonal structure during development and adulthood. In vitro, it enhances the sensitivity of neurofilament-H to calcium-dependent proteases. SNCG Protein, Human is the recombinant human-derived SNCG protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

SNCG proteins help maintain the integrity of neurofilament networks and may influence axonal structure during development and adulthood. In vitro, it enhances the sensitivity of neurofilament-H to calcium-dependent proteases. SNCG Protein, Human is the recombinant human-derived SNCG protein, expressed by E. coli , with tag free.

Background

SNCG protein plays a crucial role in maintaining neurofilament network integrity, suggesting involvement in shaping axonal architecture during both developmental stages and adulthood. Additionally, it may contribute to modulating the keratin network in the skin. In vitro studies indicate that SNCG increases the susceptibility of neurofilament-H to calcium-dependent proteases, implying a role in regulating neurofilament dynamics. Furthermore, SNCG activates the MAPK and Elk-1 signal transduction pathway and exhibits potential centrosome association. Its interaction with MYOC influences MYOC secretion and aggregation, highlighting SNCG's diverse involvement in cellular processes with implications for neuronal and skin-related functions.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. When Recombinant Human SNCG is immobilized at 2.5 µg/mL(100 µL/well) can bind Anti-SNCG. The ED50 for this effect is 147.1 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. When Recombinant Human SNCG is immobilized at 2.5 µg/mL(100 µL/well) can bind Anti-SNCG. The ED50 for this effect is 147.1 ng/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • SNCG (M1-D127)
      Accession # O76070
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    SNCG; Synuclein, Gamma (Breast Cancer-Specific Protein 1); Synuclein Gamma; Breast Cancer-Specific Gene 1; Persyn; E Pound-Synuclein; BCSG1; Ɣ-Synuclein; SR; -Synuclein; Gamma-Synuclein; PERSYN; Synoretin; PRSN; Breast Cancer-Specific Gene 1 Protein

  • AA Sequence

    MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD

  • Predicted Molecular Mass

    13.6 kDa

  • Molecular Weight

    Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00