1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. SOD2/Mn-SOD Protein, Human

SOD2/Mn-SOD protein is a key enzyme in cellular defense that neutralizes superoxide anion radicals and protects cells from oxidative stress. SOD2, as a manganese-containing superoxide dismutase, plays a key role in breaking down these free radicals and is essential for maintaining cellular homeostasis and protecting biological systems from potential damage caused by the accumulation of reactive oxygen species. SOD2/Mn-SOD Protein, Human is the recombinant human-derived SOD2/Mn-SOD protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE SOD2/Mn-SOD Protein, Human

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SOD2/Mn-SOD protein is a key enzyme in cellular defense that neutralizes superoxide anion radicals and protects cells from oxidative stress. SOD2, as a manganese-containing superoxide dismutase, plays a key role in breaking down these free radicals and is essential for maintaining cellular homeostasis and protecting biological systems from potential damage caused by the accumulation of reactive oxygen species. SOD2/Mn-SOD Protein, Human is the recombinant human-derived SOD2/Mn-SOD protein, expressed by E. coli , with tag free.

Background

The subject, SOD2/Mn-SOD Protein, serves as a crucial enzyme in cellular defense by effectively neutralizing superoxide anion radicals, which are naturally generated within cells and can be toxic to biological systems. Operating as a manganese-containing superoxide dismutase, SOD2 plays a pivotal role in breaking down these radicals, thereby safeguarding cells from the harmful effects of oxidative stress. The enzymatic activity of SOD2 is essential for maintaining cellular homeostasis and protecting biological systems from potential damage caused by the accumulation of reactive oxygen species, highlighting its significance in cellular health and resilience.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P04179 (K25-K222)

Gene ID
Molecular Construction
N-term
SOD2 (K25-K222)
Accession # P04179
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Superoxide Dismutase [Mn] Mitochondrial; SOD2
AA Sequence

KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK

Predicted Molecular Mass
22.3 kDa
Molecular Weight

Approximately 25 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

SOD2/Mn-SOD Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

SOD2/Mn-SOD Protein, Human

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SOD2/Mn-SOD Protein, Human
Cat. No.:
HY-P74538
Quantity:
MCE Japan Authorized Agent: