SOST Protein, Human (Biotinylated, HEK293, His, Avi)
Based on 1 Customer Validation
SOST proteins act as potent inhibitors of bone growth by effectively inhibiting Wnt signaling and subsequent bone formation. SOST exerts its inhibitory effect by interacting with key Wnt pathway components, including LRP4, LRP5, and LRP6. SOST Protein, Human (Biotinylated, HEK293, His, Avi) is the recombinant human-derived SOST protein, expressed by HEK293 , with C-Avi, N-10*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
SOST proteins act as potent inhibitors of bone growth by effectively inhibiting Wnt signaling and subsequent bone formation. SOST exerts its inhibitory effect by interacting with key Wnt pathway components, including LRP4, LRP5, and LRP6. SOST Protein, Human (Biotinylated, HEK293, His, Avi) is the recombinant human-derived SOST protein, expressed by HEK293 , with C-Avi, N-10*His labeled tag.
Background
SOST protein serves as a potent negative regulator of bone growth by effectively inhibiting Wnt signaling and subsequent bone formation. Through interactions with key components of the Wnt pathway, including LRP4, LRP5, and LRP6, SOST exerts its inhibitory influence. Notably, its interaction with LRP4, mediated via the extracellular domain, facilitates the suppression of Wnt signaling, while interactions with LRP5, specifically through the first two YWTD-EGF repeat domains, contribute to the inhibition of Wnt-mediated signaling. These molecular interactions underscore the crucial role of SOST in modulating the intricate signaling cascades that govern bone development, providing essential regulatory mechanisms to maintain bone homeostasis.
Verified Bioactivity
Immobilized Human LRP-6 mFc at 5 μg/mL (100 μL/well) can bind Biotinylated Human SOST His with a linear range of 0.005-2.089 μg/mL.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;N-10*His
-
Accession
Q9BQB4 (Q24-Y213)
-
Protein Length
Full Length of Mature Protein
-
Conjugation
Biotin
-
Synonyms
SOST; Sclerosteosis; Sclerostin; SOST1; DAND6; CDD; VBCH
-
AA Sequence
QGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY
-
Predicted Molecular Mass
25 kDa
-
Molecular Weight
Approximately 33 kDa (Monomer) & 66 kDa (Dimer), based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
